Last commit for bin/DotNetOpenId.dll: 5e3893ca5c8c985bf9b2a1e1dbc94d48a4eb3e96

add the executable bit to all bundled DLLs so that these are preserved when using git or untarring releases under cygwin on windows

Justin Clark-Casey (justincc) [2011-04-27 22:57:26]
add the executable bit to all bundled DLLs so that these are preserved when using git or untarring releases under cygwin on windows

Mono doesn't care if the
MZÿÿ¸@€º´	Í!¸LÍ!This program cannot be run in DOS mode.
$PEL¶FLIà!Bîa €@ À@”aW€@ ø`  H.textôA B `.rsrc@€D@@.reloc H@BÐaHÔÖ$Š¢B4{*"}*{*"}*(*(O*(M*ª(oB(o
((O(N(
*F(J(
*0(
-rps
z(
,r
ps
z(
,r/ps
z-rEps
zsD((}}sm((s]}o
*{	*"}	*{
*"}
*Š{-(}}{*0I{(ó-*{(((ô
rQpoî(
{(+(©*0K-r—ps
z(4,r±ps
z(4,rÕps
zrõp(§(¯*0x(

-(6s
zo 
rEpo!
t-Io 
o"
o 
rEpo!
t%-o 
rEps#
%o$
Þo 
o%
Ü*82j04(

-(5s
z(Os&
o'
o(
o)
*(>*:(
(*:(
(*{*"}*0"o+
`
o,
o-
(*0,-r±ps
z-rÇps
zo+
o.
.(Hs/
zs0

~s1
rÙpo2
o3
8 o4
o5

	o6
o5
	~o7
2$(8
(;	¢(9
s/
z~o7
2%(8
(;¢(9
s/
z	o:
:o;
o:
o<
o=
:TÿÿÿÞ,o>
ÜÞ
,o>
Üo?
*Z³
GÔ
0¢~s@

sA
8X(-	o5

	oB
9î	g:oC
Ži.9(8
(<:Œg¢Œh¢	¢(9
s/
z(1[ššoB
Y(D
-š(D
,9(8
(; Œg¢Œh¢	¢(9
s/
z(/šo5
¢šo5
¢ššoE
oF
%
:çþÿÿ(1UoG
joH
&oG
oI

.7(8
(<		rÝp¢	Œh¢		¢	(9
s/
zÞ
,o>
Ü*A‰•
05g

:€g
€sJ
€*0h(
-r—ps
z(¤,rãps
z-rõps
z(!(#(%(o
oo</C(8
(Joo<({¿¢({¿¢(9
s•z(¿9µoš{Á9¥($(&{É{ÑoK
-rÿp(&{È{Ñ(³*($(&{É{Ño6
(&{Á(L
,@rcp(&{È{Ñ($(&{É{Ño6
(&{Á(µ*{*"}*{*"}*{*"}*2("oš**(*š(),($(&{É{ã(S**Þ(&{Ê{î{($(&{É{ß(QoM
*:(
(,*{*"}*2-*(0*J(
,*sù*J(4,*oO
*¦(P
,ròps
z(µ,s¯*s÷*^(2,
(0Q*Q*F(µ-(**jþþa,*-*oQ
*.(4þ*"(Q
*(R
*®  } }(
, }*{*"}*{*"}*0"	(ßZ
(;2
(=þþ**(S
*08
s6
(Bo8(Do=(Fo<(Ho>*Frp(T
¥m*JrpŒm(U
*Frp(T
¥–*JrpŒ–(U
*FrXp(T
¥h*JrXpŒh(U
*Fr‚p(T
¥h*Jr‚pŒh(U
*r}#(
ào}$*Š}#(
ào}$}#*Â}#(
{$oW
t}${#}#*0J}#(
ào}$
+{$à{$à•žX
{#7á{#}#*0Ã-s
z
oB

sQoX
+3	X
8‚oX
-3wr¬psY
zoX
-
+Y02"90
(^0Y(T(V
+2(Z
,$X
+oX
(Z
-s[
zX
2ä+s[
zX
2	-s[
z*0ë
}#(
Žid}#Ži_
,%{#X}#{#ào}$ŽiY+-{$Y‘bY‘b`Y‘b`‘`žYX/Ï
	YE2+P{${#Yà‘ž+;{${#Yà‘b‘`ž+ {${#Yà‘b‘b`‘`ž(y*0S}#(
Ži}#{#ào}${#Y
+{$•žY
X/é(y*0 }#(
o
ž}$*06}#(
o
mž dmž}$}#(y*sQ*Z/rôps\
zsQ*sR*¢(n,sL*(n,sL*(™*0b(n,sL*(n,rps]
z(
YE	+(T*(š*rps]
zs^
zZ1(Ÿ*e(Ÿe*"(Ÿ**(¢š*^1( *rps]
z*(¢š*0•(n-	(n,(T*{$Žij{#n/rPps_
z{$Žij{#n/rrps_
z{#{#XsK
{${#{${#{$(¦oy*²/rps]
z-(T*3sL*(¥*"(£*"(¤*^~&-
(`
€&~&*0´c
_,X
XsKbu
	oa
	{$b(b
,OY_b{$Yo%qo`o Y_d{$Yo%qo_o+{$Yo%qo €`ooy*2(a(b*0°(f
c_,Xbu
	oa
	{$b(b
,OY_b{$Yo%qo`o Y_d{$Yo%qo_o+{$Yo%qo €`o(y*2(a(d*0B(y{${#Yà•
 € +Yd6_,ï{#YbX*0#d
_Ò_b{$à•_þþ*07/r”ps\
zd
_Ò_b{$à•`{$à•þ*&(k*&(k*0Qd
{#4C__b,{$ào%qo`o*{$ào%qof_o*0	(n,*
+X
(h,ó*0‹(n,u*(f
c_,Xu_
	-
{#Y+A{$•	Y+X ÿ_ҜdY/ß	X
Y/º*š{#.oy{#3{$•þ**¦{#.oy{#3{$•þþ**–3*(p-	(p,*(þ*¢3*(p-	(p,*(þþ*.(þ*.(þ*:(þþ*:(þþ*"(*6r¢p(x*0‚oB
jn/rìpr*psc
z3r:pr”psc
z(n,r p*(n,r¤p*r¨p
sL+(žoX
Œg(d

(o-Ü*0B+%{#Y}#{#6{${#Yà•,×{#-%{#X}#*0	
+
{$žX
j{#n2è*0!
+{$à•a
X{#7ç*&
(w*Ö-*uh,¥h2
¥o(n**t(þ*"(©*"(«*0s‡
o‹*0<	
+&~%•(n,*~%•(Y-*X
~%Ži2Ð(*0+	
+~%•(Y-*X
~%Ži2á(	*0s€
o|*0s~
ox*0„	
{$o%qoXo{$•4]{$X%
o%qoXo+{$o%qoXo{$%X
•,Ù{#3%{#X}#*
%)+/5;=CGIOSYaegkmqƒ‰‹•—£§­³µ¿ÁÅÇÓßãåéïñû
%379=KQ[]agou{…‘™£¥¯±·»ÁÉÍÏÓßçëó÷ý	#-39;AKQWY_eikwƒ‡“•¡¥«³½ÅÏ×Ýãçïõù)+57;=GUY[_mqsw‹—¡©­³¹ÇËÑ×ßåñõûý	%'-?CEIOU]ci‹“£©±½ÁÇÍÏÕáëýÿ	')/QW]ew“•™Ÿ§«­³¿ÉËÏÑÕÛçóû
#+/=AGIMSU[eyƒ…¡£­¹»ÅÍÓÙßñ÷ûý	'7EKOQUWamsy‹Ÿµ»ÃÉÍÏÓÛáëí÷!#')3?AQSY]_iqƒ›Ÿ¥­½¿ÃËÛÝáéïõù			#	%	+	/	5	C	I	M	O	U	Y	_	k	q	w	…	‰		›	£	©	­	Ç	Ù	ã	ë	ï	õ	÷	ý	

!
1
9
=
I
W
a
c
g
o
u
{


…
‹
“
—
™
Ÿ
©
«
µ
½
Á
Ï
Ù
å
ç
í
ñ
ó
#)-?GQW]eo{‰“™›·¹ÃËÏÝáéõû%/1A[_amswƒ‰‘•³µ¹»Çãåëñ÷û




!
+
-
=
?
O
U
i
y

…
‡
‹

£
«
·
½
Ç
É
Í
Ó
Õ
Û
å
ç
ó
ý
ÿ
	!'/5;KWY]kqu}‡•›±·¹ÃÑÕÛíïù
%)1CGMOSY[gk•¡£§­³µ»ÑÓÙéïûý!%+9=?Qisy{…‡‘“£¥¯±»ÁÉçñóý'-9EGY_cioƒ›¡¥§«ÃÅÑ×çïõû
#)+17AGS_qsy}—¯³µ¹¿ÁÍÑßý
'-7CEIOW]gim{‡‹‘“Ÿ¯»ÃÕÙßëíóùÿ!/3;EMYkoqu™Ÿ¡±·½ËÕãç%)+7=ACI_egk}ƒ‘—›µ»ÁÅÍ×÷	%39=EOUimou“—Ÿ©¯µ½ÃÏÓÙÛáåëí÷ù	#'3A]cn o%Ð3(f
€%*0G(
}+{#b
XsK},{,{$àž{,(\},*0	8{+
{#XY
{#4*{$Žij{#n/rªps_
z{#	Y{,{#XsK{$	{#	Y{,{${,{#{$(¦{#5{#+}#oysK{${#Y{${#{$(§oy(s,
(›+0XsK{$àž(›(œ+(›(t-ð*0©(n-	(n,(T*{#{+{#b7{+(Z{#{+{#b7{+(Z{#{+{#7(ˆ{#{+{#7(ˆ(]sL
(ˆ*0(
YE	+(T*(W+(W+s^
z{+(t,+{#{+{#b7{+(Z+(ˆ3
{+(W*’{+{$•_3	(*(Œ*0æ(T{+{#bsM
{+(Z{+{#bsMof{+{#bào
8og,W		Ži(g
{${#{${#	(¦%{#{#X}#	{$
}$(ˆ(¨(ˆ(n,*XDwÿÿÿ*0(T{+(”{+{#bsM
{+(”{+{#bsM{+{$•(“of
{+{#bào8‰og,cŽi(g
{${#{${#(¦%{#{#X}#{$}${+(•&(¨{+(•&X	Doÿÿÿ{+(•&*0J.${+{$•_3	(*(*{+{$•_3(’*(‘*0· oy{+{#bào
(S{+(”{+{#bsM{+{$•(“ofY
(¨{+(•	og9j{$Xà•nnZX{$Xàmž dX%{#7Ä{#{+{#4Hj;¼{$Xàmž%{#X}#+{+(›{+(t-æ8}j;fmn b{$XYà•n`{+{${+{#Yà•Xn\mj{+{$à•nnZX{$Xà•	{$Xào%qomYo d{$Xà•	6jXX{#7‰mY9€
{+{$à•


X%

þ{$Xào%qo
Y%o
fþ`,
+
X{#7¨
Y+{+(›{+(t-æ+{+(›{+(t-æ	%Y
Bµýÿÿ{+(•*0‰!oy{+{#bào
(S{+{#bsMofY(¨{#{+{#7(ˆog9
j{$	Xà•nnZX{$	Xàmž dX%{#7Æ{#{+{#4Gj;³{$	Xàmž%{#X}#+{+(›{+(t-æ8uj;^mn b{$	XYà•n`{+{${+{#Yà•Xn\mj{+{$à•nnZX{$	Xà•{$	Xào%qomYo d{$	Xà•6jXX{#7ŒmY,	
{+{$
à•	X%	þ{$	
Xào%qoY%
o
fþ`,	+	
X

{#7©	Y+{+(›{+(t-æ+{+(›{+(t-æ%YBµýÿÿ*0~"oy{+{#bào
(T{+{#bsM{${#Yà• €
+	d
	_,÷	d
{#Y{$à•(¨{#{+{#7(ˆ	_9Æ{#X	+*{$à•{$àb	`žd	X7Ð	-{+(t,m
{+{$à•


X%

þ{$%Xào%qo
Y%o
fþ`,
+
X7ª	d%
Bÿÿÿ €
%YBçþÿÿ*0X#{+{#bào
(T{+(”{+{#bsM{+{$•(“ofY
(¨{+(•	og9Å{#X+*{$à•{$àb`ždX7Ð-{+(t,l	
	{+{$%Xà•
X%
þ{$%Xào%qoY%
o
fþ`,
+
7¢	%Y
Bÿÿÿ{+(•*0
+YZ
Z%3ònem*¢oyoy{# Z(_(Z*0ˆ$

80{$à•Zn{$%Xà•nZ{$%Xà•nX d	+In{$%Xà•nZ{$%Xà•nXX{$%Xàmž d	X		{#7­+B{$%Xà•nX{$%Xàmž dj3	X	+6	X		{#7´+${$%Xà{$%Xà•ž	X		{#7Ò{$%Xàmž	X
	{#DÄþÿÿ+%{#Y}#{#6{${#XYà•,Õ(t,(›*V{$•(“(•*(
*(
*0%{#{#4{$
{#
{${#+{$
{#
{${#	XsK{$jà•nà•nXXàmž dX%7Ôjþþ,F	4%àà•X%	ž	þX%	4-Û,àžX%}#*	4àà•žX%	7ëoy*0È&{#sK
{${${$
	à•X%þàà•Y%žfþ`,+X%{#7¼{#.J3,àà•Yž%Xà•-
{#7Þ{#.àà•žX%{#7çoy*0Ï'{$
{$
à•	X%	þào%qoY%ofþ`,
+
X%{#7º{#.<	38ào%qoYo%Xà•-{#7Ø+%{#Y}#{#6{${#Yà•,×{#-%{#X}#*0({#{#4!{$
{#
{${#+{$
{#
{${#{$jà•nà•nXXàmž dX%7Ôjþþ,C	4%àà•X%	ž	þX%	4-Û,àžX%}#*,	Y4àà•žX%	7ë	X}#oy*0Ÿ{#
{#+Y
6{$Yà•,ë+Y6
{$Yà•,ë--*4*6*Y+Y,{$à•{$à•.å{$à•{$à•4*{$à•{$à•6**0B)j
{#+% b
{$à•n`
{$àn\mžn^
%Y5Óoym*0.)j
{#+ b
{$à•n`
n^
%Y5ám*0N*{#sK
j{#+% b{$à•n`{$àn\mžn^%Y5Óoy*0i+{#sK
j{#+% b{$à•n`{$àn\mžn^%Y5Óoym(S
¢	¢*0”,(3(T¢sL¢*oyoy{#3{$•(¡*{#X
{#X €{${#Yà•
{#{#Y+
Xd,	_,î{#{#YXsK(_{$(_{#Y	Y
{${#Yà•{${#Yà•n8D
•n b
Y•nX

n\
n^!.Z b
Y•nX6jYnX!7Â
YXjm{$à•nnZX•o%qomYo d•6jXXXnj2£
YXj.CYj•n{$à•nXXmž dXXnj2Ç{$%Yž
Y
	Y		=´þÿÿoyoy¢¢,%š(`¢*0«--{#XsM*c
_{#XXsK{#
,f+2{$à•{$njXÔ_b`ž Y_dX	7Ê{$njXÔž+{$njXÔ{$à•žX	7âoy*0•.-sL*c
_{#YXsK{$ŽiY
,S+.{$	njXԕ{$	à_d`ž Y_b	%Y
5Ê+{$	à{$	njXԕž	%Y
5âoy*0T/{#XsK
j{$à•nnZX{$àmž dX%{#7Ó{$àmžoy*0’0
X
	XXXX+h	à•,Xj	
+5	à•n
à•nZ	à•nXX	àmž d
X
	X	
7Åj.		àmž	X
X	7“*0·1
njXm
	njXmnjXmnjXmnjXmnjXm+t	à•,dj	
+5		à•nà•nZ
à•nXX	
à	mž	 d	X
X
4
7¿	j.
4	
à	mž	X
X	7‡*02P
{$Q{${#}$
Ži+àžX7î		8à•,nj
à•X	ZXX
	X+7
nà•nZ
à•nXX

à
mž
 d
X
X
X7Ä
j.
à
mž	X	X	Dwÿÿÿ+ à•àb`ždX7Ú,àž	X8›à•nà•nZà•nXàmž dX%ào%qomXoà•m4CX%ào%qoXo+ào%qoXo%Xà•,ÞXXD\ÿÿÿ%{#b}#+%{#Y}#{#XYà•-	{#5Ù*0—3
+(Z
{#5ë(n,*{$•
	(Y+d	d
X	`_,è+-d_,ô+	d
	_,÷	7
	Yd+	Yd
-Õ	_b(S*0>4
(Y
+)3	*\	ZX^
,3Y*	\ZX
^-Ô*05{#3{$•(ª(S*		(T¢	(T¢


(T¢
(T¢

s‡+Y	1"ššš(]oŠš¢¢(¢š¢š¢š¢š¢š	X
(o-š(o,rÈps]
zššš(]oŠ*2ràp(²*†(
(P
,r,ps
z}0*{2*"}2*{3*"}3*ê(µ(P
,*(¸(P
,(µsi
*(µ(¸sj
*{4*"}4*{.*086}.(k
, (l

rFp(m
(n
}-*}-*{-*0e6,N~/oo
-(^rôpsc
z(p
,sq
}.+%r\p(§|.þ+|.þ}-*{5*"}5*{6*"}6*{7*"}7*{8*"}8*0T7{1-E(Ä(P
-8r¨p
(Ä
(Â(P
-r›p(Â(r

(s
}1{1*0I	}1-+ot
(Å-+
ou
-ov

0+ou
Xow
(Ã*{9*"}9*{0*`*0P8-rŸps
zsA

(¼,rËp(¼oE
(Â(P
-rÓp(ÂoE
(µ,rãp(µoO
oE
(¸(P
-rïp(¸oE
(¾(x
,?(¾(y
3	(x
+,rprpoE
+rprpoE
(Ä(P
-rp(ÄoE
(³(P
-r)p(³oE
(À(P
-r;p(ÀoE
(È(P
-rMp(ÈoE
*0F9-*	þ	(»
þ
(¿r)poz
&(´rãpoz
&(¶rïpoz
&(¹rËpoz
,+	oB

3~/	oo
,		(½+r_p	(³rpoz
,?%,8rp({
-rp({
-+s|
(¿+s|
(¿r;poz
&(ÁrÓpoz
&(Ãrpoz
&(ÅrMpoz
&(É*0%:(m
rúp
¢([¢(9
*0t;s}

r	po~
&r)poz
,r)p(Îo~
&rãpoz
,rãp(Îo~
&rïpoz
,rïp	(Îo~
&rËpoz
,rËp(Îo~
&rpoz
,rp(Îo~
&r;poz
,r;p(Îo~
&rÓpoz
,rÓp(Îo~
&rpoz
,rp(Îo~
&rMp	oz
,rMp	(Îo~
&o
Yo€
,3%o
Yo
r	po~
&oO
*v--*þþa,*oQ
*.(Ðþ*0Ø<u
(Ð,*(ºŒoºŒ(Ó9¤(ÂoÂ(Ó9Ž(ÄoÄ(Ó,{(µoµ(Ó,h(¸o¸(Ó,U(¾Œo¾Œ(Ó,8(³o³(Ó,%(ÀoÀ(Ó,(ÈoÈ(Ó**v--*þþa,*oQ
*Br	ps‚
€/*0I(
-rB	ps
z-rR	ps
z(Û%-&s„
(Ý(ß(á*{:*"}:*{;*"};*{<*"}<*{=*"}=*0¹(
-(,s
z(
o…
o†
(
o…
(Úo‡
(Ü(
o…
(P(Þ,B(ÞŽi17(
o…
oˆ
(Þ(ÞŽio‰
(
o…
oˆ
oŠ
(
o…
oˆ
o‹
(
o…
oŒ
*0X=(à,J(ào‹(
,7(ào‰3)(ào‹s&

(àoŠ(Fo)
*s^
z0[(
-rãps
z(í{(ë(ê(}>(ê(÷(ò{>(ø(ð*{@*"}@*{A*"}A*{B*"}B*{C*"}C*0L>(
o,
o3

+	o4
{È{ÐoŽ
,Þ	o=
-ÙÞ
	,	o>
Ü**+>
0?-rãps
z{o{È{Ô(Q
o{Ê{í{ý({
-o{Ê{í{ü({
,s×8†o{Ê{í{þ({
,	so+`o{Ê{í{ÿ({
,	s@+:(8
(?
	o{È{Ô¢	¢	(9
{s“zÞsYÞ**Îø‰Z{>{¿(o*"}?*0§@oö-(Zs
z{?:‚o÷
uZ,Z(ïoùo

+2	o
o(‘
(’
o“
o’(‘
o”
	o=
-ÆÞ
	,	o>
Ü(ì{oW}?{?*A>
(ù*f(ïo¬o®oú*0uA(ño¬oû
,o¬o(*o­,Eo­o3

+#	o4
(ñoû
,o(Þ	o=
-ÕÞ
	,	o>
Ü**8/g
0;BþŒ,þ+(+
Œ(ü-
þ	**0mC-r\	ps
zÐ(–
o—
-4(8
(aÐ(–
o˜
¢(9
r\	psc
z(™
t
(ü-**0#Drx	p
(8
oî¢(9
*(O*(M*–(o
(oš
(O(N(*>(J(*0‰s[}Hs5}I(}K(
(ooA((þsœ
o9}E,o
(
,-rEps
z}F}G*0)E(ož

o=
,oŸ
*(Qs•z0(E(	ož

o=
,oŸ
*(Qs•z0'E(
ož

o=
,oŸ
*(Qs•z0=-rž	ps
z(
,rª	ps
zs&

o 
ooŽ
,;o 
ooŽ
-'oo 
ooB
ow
(¡
o¢
o)
(w(+*0F(
-(,s
z(Os&

~£
o'
(Lo¤
s¥
o¦
+#o§
t`
	(-		o¨
oE
o=
-ÔÞu
,o>
Ü(Fo)
(*B0r0|=(
-(,s
z(Os&

(
o©
oª
o¢
o'
o(
o 
rÂ	po«
-%o 
rÂ	p(¡
o¢
o)
sw(	*0(G~¾
{È{ÐoŽ
-~O({
**02G{G-*{G(
{G{È{ÔoK
-**0AH{J-2(,*{G{F(½}JÞ
s]}JÞ{J*+‰{H*{K*Z-rôps
z}K*0wI(((¬

,*o†(­
9²o†
(­
9Ÿo†(®
o†(®
(¯

,*o‡(­
,9o‡(­
,(o‡		(®


o‡(®
(¯
*o‡(­
,*o‡

(­
,**o†(­
,*o†(­
,*o‡(­
,9o‡(­
,(o‡(®
o‡(®
(¯
*o‡(­
,*o‡(­
,**z~N-þs°
€N~N*0z~¼{Ão…,
#*~¼{Âo…,
#ð?*~»{Âo…,
#@*~º{Âo…,
#@*#$@*{L*"}L*0xJ(

-(6s
zo 
rÆ	po!
t1-Io 
o"
o 
rÆ	po!
t1%-o 
rÆ	ps_%o$
Þo 
o%
Ü*82j{M*"}M*"}J*(*~(
s±
(-s±
(/*{O*"}O*{P*"}P*{Q*"}Q*0
Ku
-*(*o*(²
(²
3!(²
,(³
(³
(´
++,*(,o.
o,o.
.*(,o3
+o4
o,oµ
-
Þso=
-ÝÞ,o>
Ü(.o.
o.o.
.*(.o3
+o4
o.oµ
-
Þo=
-ÝÞ,o>
Ü*	*y' Ó'ú2(,oR
*0áLsA

(*
(²
,1r6
p(*(¶
(·
(m
(¸
oE
rP
p(,(6oE
(.o.
1tsV(.~¬oNoRo3
+ o4
r€
p(¡
oPoE
o=
-×Þ,o>
Ürž
p(.(7oE
*-¼0M-*rP
poK
-*r6
poz
-þ+(m
(¹
(º
s»
(+(,o¼
rP
po6
g o½
	+!	šoB
1(,o¾
	X		Ži2×(.o¼
(8
rž
poz
,Og

 
o½
+)šoB
,(.	oPo¾
XŽi2Ï*rÔ
p*`*(9*0>Ns¿

o3
+o4
oLo”
o=
-äÞ
,o>
Ü(9*
 -
0pOsV
o

+@	o
(‘
r€
poŽ
,%(‘
r€
poB
ow
(’
oM	o=
-¸Þ
	,	o>
Ü~¬oO*
LY
0Ps}

(+o3
+Io4
r,poÀ
,!(8
(C
	¢	(9
sY
zo~
&r,po~
&o=
-¯Þ
,o>
Üo
1%o
Yo
oO
*Ug
0<Q(Æ
oÇ
{È
3{É
þ3}É

+sÊ

{Ë
}Ì
*(Í
*0ÈR{É
E¢ˆ8}É
{Ì
oÎ
sÏ
}Ð
{Ì
oÁ
}Ñ
}É
+S{Ñ
oÃ
}Ò
{Ð
{Ò
oÓ
-/{Ð
{Ò
oÔ
{Ò
}Õ
}É

Þ%}É
{Ñ
o=
- (Ö

Þ(×
Ü*¿¿{Õ
*sØ
z0"	{É

YE*Þ(Ö
Ü*2{Õ
Œ"*z(
}É
(Æ
oÇ
}È
*n}É
{Ñ
,{Ñ
o>
*0SþsÙ

}Ú
*š(
(>(@(?oA(B*~(
(>oÛ
sÜ
(B*{X*"}X*{Y*"}Y*{Z*"}Z*0-T((F($(&{É{ÝoK
,(D*(&{¿oÝ
?á($(&{É{Ö(Q(&{Ê{ê{ï({
9§($(&{É{Ü(Q
($(&{É{Þ(Q(&{Ê{ìo/(+2Q(&{Ê{ëo+(+23( o(&o?,( ("(™(K*0÷U($(&{É{Ü(Q
(&{Ê{ìo/(+?($(&{É{Þoz
,(&{Ê{ë{ôoM
,(&{É{é(I8ˆ(&{É{ç(I
(&{É{è(I(&(û(E	(þÞ<(8
(?		(&{È{Þ¢	¢	(9
s”z($(&{É{Ý(Q($(&{É{Û(Q(m
(ß
(à
(&(Ý(HÞt(8
(?

(&{È{Ü¢
¢
(9
s”z(8
(?(&{È{Ü¢¢(9
s•z*–Lâ<ai‚<a{[*"}[*{\*"}\*0:V($(Q(á
Þ$
(8
(.¢(9
s‘z*$q{]*"}]*0-7(P
,r0ps
z{eoâ
,*(U*0A(P
,r@ps
z(P
,r0ps
z{foE
{eoE
*0‘W,No3

+1	o4

{eoã
-oz
,(S-(M	o=
-ÇÞ
	,	o>
Üo3
+o4
{eoã
-(U&o=
-ÙÞ,o>
Ü*
=G
Y+„0oX-rLps
zo
+Co

{e(‘
oã
-({f(’
oã
-(’
(‘
(Mo=
-µÞ
,o>
Ü*Od
07(Q
-r@ps\
z*0&7(P
,r@ps
z
{foâ
&*2{foä
*‚(P
,r@ps
z{foã
*’r0p(P
,r0ps
z{eoã
*0JD(m
{d{eoå
XŒh¢(9

{eoE
{foE
*¢r€p}dsA
}esA
}f(
*0æY-r’ps
zo‰
s„
YE\8’r¢p(
oŠ(+(¢u- È+ 
rðpoæ
	~0oŠosÙ+Yr"p(
oŠ(+(¢(X~i0
oY+(oZ+rbp(³ usÙ*0KZ
oŠo
+%o
(‘
oB
X
(’
oB
X
o=
-ÓÞ
,o>
Ü*1?
0Y[s„

o‹s&
oŠ(Fo)
oç
oæ
ršpo)
oç
(¡ .usÙ*0¡\s„

s0
sè
s}

oŠo
+-o
	rÀp(‘
(é
(’
(é
oê
&o=
-ÊÞ,o>
Ür$
po‹oç
(é
	oë
oì
 Èo?
sÙ*&:`. €i*(
*†([-r9prMpsí
z}j*0&]uZ
,o–,{jon(W*0M^sî

s?r›poï
sãr­poï
s)r¿poï
s‡rÉpoï
€k*(
*frÓp(ð
t%%-&sb*N(ñ
(ò
oó
*Frp(T
¥!*JrpŒ!(U
*Fr7p(T
¥!*Jr7pŒ!(U
*FrGp(T
¥h*JrGpŒh(U
*Frmp(T
¥h*JrmpŒh(U
*jr•p(T
t¨%-&sj*6r•p(U
*jr³p(T
t¨%-&sj*6r³p(U
*jrÑp(T
t¨%-&sj*6rÑp(U
*jrùp(T
t¨%-&sj*6rùp(U
*2-*sv*^(
-*oç
sv*2-*oO
*Jo÷
oø
où
*0´:(
-r!ps
zr3p(ú
({r3p~x-þŠsû
€x~x(ü
sý
}u{uoþ
rOpoM
-C{uoþ
rYpoM
-+(8
(A
{uoþ
¢(9
sÿ
z*0}:(
(
,r!ps
z}u{uoþ
rOpoM
-C{uoþ
rYpoM
-+(8
(A
{uoþ
¢(9
sÿ
z*6(y(v*V-reps
zoO
*{w*"}w*2{uo
*2{uoþ
*2{uo
*2{uo
*2{uo
*{u*08=(z,)(s&

r…po
(¡
o
o)
*(*0v_(|rpoM
,*(|g.o½

ŽiYš~v(+/*oB
3Ži3*ŽiYšoB
0Žiþ*Žiþ**6sý
(…*0`oþ
(}(L
,*o
(~.*(z-o
(|(L
,t*(|g.o½

o
g.o½
ŽiŽi1*+&ŽiYYš
ŽiYYš	(
-*XŽi2Ô(€o
oM
-(€rÂ	poM
,*(€oB
o
oB
1*(€oB
o
o
(€(L
,*(€r£poÀ
,o
oX
&þ*(€rÂ	po«
-#o
oX
?.o
oX
/þ**0‡a(‚(ö(
,i-<oo
(
,)(8
(Xo
¢(9
s•zo,"os±o¸
Þ(Ds”z)*	*\q
–00bu&
-*{u{uoQ
,(zozþ**f{uoR
(z-+X*0==(z,){us&

r§po
(¡
o
(G*{uoç
*0‰
 `
r­p¢rµp¢r½p¢rÅp¢rÍp¢rÕp¢rÝp¢råp¢ríp¢	r÷p¢
rp¢rp¢rp¢
r#p¢r)p¢r/p¢r5p¢r;p¢rAp¢rGp¢rMp¢rSp¢rYp¢r_p¢rep¢rkp¢rqp¢rwp¢r}p¢rƒp¢r‰p¢rp¢ r•p¢!r›p¢"r¡p¢#r§p¢$r­p¢%r³p¢&r¹p¢'r¿p¢(rÅp¢)rËp¢*rÑp¢+r×p¢,rÝp¢-rãp¢.rép¢/rïp¢0rõp¢1rûp¢2rp¢3rp¢4r
p¢5rp¢6rp¢7rp¢8r%p¢9r+p¢:r1p¢;r7p¢<r=p¢=rCp¢>rIp¢?rOp¢@rUp¢Ar[p¢Brap¢Crgp¢Drmp¢Ersp¢Fryp¢Grp¢Hr…p¢Ir‹p¢Jr‘p¢Kr—p¢Lrp¢Mr£p¢Nr©p¢Or¯p¢Prµp¢Qr»p¢RrÁp¢SrÇp¢TrÍp¢UrÓp¢VrÙp¢Wrßp¢Xråp¢Yrëp¢Zrñp¢[r÷p¢\rýp¢]rp¢^r	p¢_rp¢`rp¢arp¢br!p¢cr'p¢dr-p¢er3p¢fr9p¢gr?p¢hrEp¢irKp¢jrQp¢krWp¢lr]p¢mrcp¢nrip¢orop¢prup¢qr{p¢rrp¢sr‡p¢trp¢ur“p¢vr™p¢wrŸp¢xr¥p¢yr«p¢zr±p¢{r·p¢|r½p¢}rÃp¢~rÉp¢rÏp¢ €rÕp¢ rÛp¢ ‚ráp¢ ƒrçp¢ „ríp¢ …róp¢ †rùp¢ ‡rÿp¢ ˆrp¢ ‰rp¢ Šrp¢ ‹rp¢ Œrp¢ r#p¢ Žr)p¢ r/p¢ r5p¢ ‘r;p¢ ’rAp¢ “rGp¢ ”rMp¢ •rSp¢ –rYp¢ —r_p¢ ˜rep¢ ™rkp¢ šrqp¢ ›rwp¢ œr}p¢ rƒp¢ žr‰p¢ Ÿrp¢  r•p¢ ¡r›p¢ ¢r¡p¢ £r§p¢ ¤r­p¢ ¥r³p¢ ¦r¹p¢ §r¿p¢ ¨rÅp¢ ©rËp¢ ªrÑp¢ «r×p¢ ¬rÝp¢ ­rãp¢ ®rép¢ ¯rïp¢ °rõp¢ ±rûp¢ ²rp¢ ³rp¢ ´r
p¢ µrp¢ ¶rp¢ ·rp¢ ¸r%p¢ ¹r+p¢ ºr1p¢ »r7p¢ ¼r=p¢ ½rCp¢ ¾rIp¢ ¿rOp¢ ÀrUp¢ Ár[p¢ Ârap¢ Ãrgp¢ Ärmp¢ Årsp¢ Æryp¢ Çrp¢ Èr…p¢ Ér‹p¢ Êr‘p¢ Ër—p¢ Ìrp¢ Ír£p¢ Îr©p¢ Ïr¯p¢ Ðrµp¢ Ñr»p¢ ÒrÁp¢ ÓrÇp¢ ÔrÍp¢ ÕrÓp¢ ÖrÙp¢ ×rßp¢ Øråp¢ Ùrëp¢ Úrñp¢ Ûr÷p¢ Ürýp¢ Ýrp¢ Þr	p¢ ßrp¢ àrp¢ árp¢ âr!p¢ ãr'p¢ är-p¢ år3p¢ ær9p¢ çr?p¢ èrEp¢ érKp¢ êrQp¢ ërWp¢ ìr]p¢ írcp¢ îrip¢ ïrop¢ ðrup¢ ñr{p¢ òrp¢ ór‡p¢ ôrp¢ õr“p¢ ör™p¢ ÷rŸp¢ ør¥p¢ ùr«p¢ úr±p¢ ûr·p¢ ür½p¢ ýrÃp¢ þrÉp¢ ÿrÏp¢€v*0œ(
-r—ps
z(¤,rãps
z-rõps
z(“(Ž(‘({Á,C(({È{ÑoK
-&(({È{Ñ({Áo“
*{y*"}y*2(oš*{z*"}z*{{*"}{*0BrÕp(oˆ(
((+(£(’{I((o3*J(Œ(—*{}*"}}*0kT-r—ps
z(¤,rãps
zošoo;s
oo=s
(à,(™*r!p(ª*0Ïc-r—ps
z(¤,rãps
z-rúps
z-rps
zoš(á-)(8
(8¢¢(9
s•zsA

oš{È{Ô{Ê{í{ÿoE
{È{ÜoE
oˆoþ
~	
({
,K,Gr*poˆ{Ê{ë{ô(©{È{Þ{Ê{ë{ôoE
8«r*poˆ(©(ýoO
	(ÿ{È{ÞoE
{È{æoE
oQ{›~Ï3{œ~Î.:{È{ä{›(ÿoE
{È{å{œ(ÿoE
s•*0bH{|-S(’((”(–sC}|Þ.
{ž,#(’({ž(–sC}|Þ{|*%-.‰V(
(}~*{€*"}€*{Ä*0P{-.~-þŸs

€~{~(+}{,{*rÃps
z{ƒ*0O:-rPps
zo/(£,&(8
("
o/¢(9
s/
z{ƒo
*0Ed{ƒo
+(


o/({
,Þ(
-ÝÞþ'o>
Ü**'3:(¢þþ*6(¥(
*{„*"}„*rdp*`*0EesA
ržp{‚oE

(¤,r¨p(¥oç
oE
{ƒ(ª*0fsV
o
8ào
o/oLr¾p(¡
o/oE
o19©o1o.
.~rÊp(¡
o1o.
(m
(
oE

+@(m
rØp¢	XŒh¢(9
o1	o
oE
	X
	o1o.
2²+rôp(¡
o1o
oE
o=
:ÿÿÿÞ,o>
Ü*ó0zg-*ržpoz
&{‚(L
,*r¨poz
&(
,(¦(¬o
+o

	(¡o=
-èÞ,o>
Ü*Pl0<h(Æ
oÇ
{K3{Jþ3}J
+s
{M}L*(*0ùi{JEÑ´8Ì}J{L(­}N{NoRo3
}T}J8|{To4
}O{N{OoPs-}P}Q}R{LrÊp{O(¡
|Soz
,8{S|Q(
,	{Q0rp{O(³8í}R{R,w
+h{L(m
rØp{O¢Œh¢(9
oz
,{Po1o¾
+rpp{Po/(³X
{Q1+I{Lrôp{O(¡
oz
,{Po1o¾
+rpp{Po/(³+{P}I}J
Þ(}J{To=
:tþÿÿ(
Þ(Ü	*Aðð{I*sØ
z0"j{J
	YE*Þ(Ü*{I*z(
}J(Æ
oÇ
}K*n}J{T,{To>
*0hþs
}M*.,:0ƒOsV
o

+^	o
(‘
r¾poŽ
,C(‘
ow
g%Ð4(f
o7
2
r¶p(³+(’
oM	o=
-šÞ
	,	o>
Ü*
jw
vrp}‚s
}ƒ(
*&(°*0h:(*(µ-!(8
(E
¢(9
sY
zr$p}ˆ,%{ˆršp(¡
}ˆ(²(¶(´*{‰*"}‰*{Š*"}Š*ö(P
,r²ps
z~‡o7
,rºpoŽ
-
r¾poŽ
**ªo5
r¾poŽ
,r¾poB
ow
*0":(m
{ˆ
¢(9
sý
*02k(·(ƒ
o(
s°o¼-(es•z*6(¸o´*6(¸o´*
*n(+-(/s°+Q*0$lu+
(4,*(³o³({
*2(³oR
*(³*=@+$!^g%Ð5(f
€‡*&(;*2(?tL*00m(=rÌp(Ao

-
þ*o
s
*0`ns

(=ràp(Ao
o
+o§
t"sþo
o=
-ßÞu

	,	o>
Üo
*"%G0<o(Æ
oÇ
{W3{Vþ3}V
+s%
{X}X*(*0¸R{VE’x8}V{X(=rðp{X(Ao
o
}Z}V+?{Zo§
t"}Y{Y{XsB}U}V
Þ%}V{Zo=
-´(&
Þ(#Ü*¯¯{U*sØ
z0"	{V
YE*Þ(&Ü*{U*z(
}V(Æ
oÇ
}W*²}V{Zu
}[{[,{[o>
*0oþs%
}X*0kp(=rðp(Ao

o 
`o
+o§
t"
%X	o!
¢o=
-ÝÞu
,o>
Ü*-'T0Cq(=rp(Ao
%-&(=rp(Ao

-+o!
(-*0sr-*(Ã
(­
,6oÃ(­
,&(Ã(®

oÃ(®
(¯
*(Ã(­
,*oÃ(­
,**"(é*{Ž*"}Ž*03Dr>p
(ÿ(
(8
(Ê¢(9
(r
**(Œ*0[s-r—ps
zoš
{È{áo6
-*`{É{Ý¢{É{à¢{É{á¢{É{ã¢g,o½

Ži	ŽiX`Ži("
	Ži	Ži(#
sA
o,
o3
	+P	o4
{È{ÐoŽ
,2{È{ÐoB
ow
(+1o6
o$
	o=
-§Þ	,	o>
Ü{È{Ô{Ê{í{þo$
sÕ*Æ]#²{-(’((”s'}{*:(
}*>(-*(*0tr†p(%
&
Þ&
Þ*Br–p(&
s*6{o'
*:{o(
*N{(m
o)
*:{o*
*>{o+
*F{o,
*>{o)
*6{o-
*:{o.
*N{(m
o/
*:{o0
*>{o1
*F{o2
*>{o/
*6{o3
*:{o4
*N{(m
o5
*:{o6
*>{o7
*F{o8
*>{o5
*6{o9
*:{o:
*N{(m
o;
*:{o<
*>{o=
*F{o>
*>{o;
*6{o?
*:{o@
*N{(m
oA
*:{oB
*>{oC
*F{oD
*>{oA
*2{oE
*2{oF
*2{oG
*2{oH
*2{oI
*N(
s±
(2*¶(
(P
,r0ps
z(0s±
(2*Ê(
(P
,r0ps
z(0%-&`(2*{‘*"}‘*{’*"}’*0£u(¤,rãps
z-r°ps
z~/oÁ

oˆ(„o ô37osJ
oK
(8
(V¢(9
s•z(¼,o+
~0oor¾poˆ(
(+(£Þ.r p(
	(¢rŠ ps”zrú ps”zo .2oš{É{Ô(Soš{Ê{í{ú({
,:(8
(Voš{É{Õ(S¢(9
s“zo È3*(8
(W		oŒ¢	(9
s•z2¿a2ÞŸ(
*Ž(*(4,rF!ps
z}“*E*F{“o8s6*6{“o9*2{“oO
*6{“oQ
*2{“oR
*r(
-rj!ps
z}”*F{”o#(/*2{”o$*>{”o%þ*‚{”o&-*{”o&oL
*&(;*2(=o!
*0œv-rõps
zo+
-~£
*o+

ZsM

o
+?o
(‘
(N
o~
&=oO
&(’
(N
o~
&&oO
&o=
-¹Þ
,o>
Ü%o
Yo
oO
*2K}
2(J(D*0ow-r|!ps
z,]o+
1T2o+

ZXsM

oP
(P
-oP
ow
o~
&&oO
&(Do~
&oO
o'
*Jo÷
oø
où
*0u7oQ
P3oR
rOp(
- oQ
 »3DoR
rYp(
,1oO

rŒ!p~•-þHsû
€•~•(S
*oO
*0Ex(T
oU

r¸!poÀ
(m
rø!p¢-r"p+r"p¢(9
*0?y-*o¤
s¥

+oV
oW

,	oE
Xo¤
2Ø*0Kz-*o+
sX

o
+o
(‘
(’
oY
o=
-ÝÞ
,o>
Ü*'?
0L{(
-(,s
z(
o©

oZ
o
o[
({
,o\
*(Oo]
(^
*0@|(
-(,s
z(
o©

o_
r."p({
,(L+o`
*.(M(J*00}(

-(,s
zo©
oZ
o©
o[
sa
*0}~-rB	ps
z-rj!ps
zo¦
+<o§
t`
%,r6"p({
,ob
oc
+o¨
od
o=
-¼Þu

	,	o>
Ü*#Hk0SD-rEps
z-rP"ps
zoz
,oB
-"(8
(M¢(9
s“z*0KD-rEps
z-rP"ps
zoz
-"(8
(M¢(9
s“z*0(7-rEps
z-rP"ps
zoz
&*0:(Q
(á
Þ'&(8
(@¢¢(9
s“z*	'q0?(S
-*(á
Þ'&(8
(@¢¢(9
s“z*
	'q0A€(Q(-
Þ0&(8
(?¢(Q¢¢(9
s•z*0•0A(Qsý

Þ0&(8
(?¢(Q¢¢(9
s•z*0•0N‚(S
oB
0+(sÞ/(8
(?
	¢	(S¢	(9
sz*/•(
*f}\o÷
oø
où
*0cƒs'}\r3pþ(sû
(ü

(Ooe
sa
s&
{\,r§po
(¡
o
sx&*0Z	-rX"ps
z-rd"ps
zŽiŽi.*
+(þ£ŒþoQ
-*X
Ži2Ò*0m„-rr"p*sf

~—og
+(h
(‘
(’
oi
&(j
-ÚÞþ.o>
Ü'ok
&'oO
&oO
**E0‚…~½ol

+X(m

on
+/oo
Œ,op
ŒþoQ
,Þ2o=
-ÈÞ,o>
Ü(q
-ŸÞþ0o>
Ü**<Yep0&†(+on

o=
-
þ*oo
*0H‡(Æ
oÇ
{r
3{s
þ3}s

+st

{u
}v
{w
}x
*(y
*0žR{s
Ex^+v}s
{v
oÁ
}z
}s
+B{z
oÃ
}{
{x
{{
o|
,{{
}}
}s

Þ%}s
{z
o=
-±(~

Þ(
Ü*••{}
*sØ
z0"	{s

YE*Þ(~
Ü*2{}
Œ"*z(
}s
(Æ
oÇ
}r
*n}s
{z
,{z
o>
*0ˆþs€

}
}‚
*05‰on
+oo

oƒ
,Þo=
-äÞ
,o>
Ü** '
0<Š(Æ
oÇ
{„
3{…
þ3}…

+s†

{‡
}ˆ
*(‰
*0R{…
EjP+h}…
{ˆ
oÂ
}Š
}…
+4{Š
o§
}‹
{‹
¥"}Œ
}…

Þ%}…
{Š
o=
-¿(

Þ(Ž
Ü*‡‡{Œ
*sØ
z0"	{…

YE*Þ(
Ü*2{Œ
Œ"*z(
}…
(Æ
oÇ
}„
*²}…
{Š
u
}
{
,{
o>
*0‹þs

}‘
*03Œ
oÂ
+o§
&X
o=
-íÞu
,o>
Ü*	 0‰--*-r|"ps
z-r"ps
zon

on
o=
o=

,A	,>oo
Œoo
Œ-,Êþþa,*oQ
-°*	þ*(
*0~Ž{’
u;
- È+	o“
(ZsM
{’
o”

+0	o•
r¤"p(–
Œ"(—
Œ@(
o˜
&	o=
-ÈÞ
	,	o>
ÜoO
*1<m
0%s™

}š
{š
þ›
sœ
s
*"(+*(
*0…s}

{ž
9ær¾"poŸ
&oÁ
+toÃ
Œ"-rÄ"p+
þ"oO
(
(
rÒ"p(¡
o 
rÒ"po~
&o~
&(
o¡
-o¢
&rÖ"poŸ
&o=
-ƒÞ,o>
Üo
1%o
(
oB
XYo
+%o
Yo
rà"po~
&oO
*rä"po~
&oÁ
+7oÃ

	Œ"-rÄ"p+
þ"oO
o~
&rè"poŸ
&o=
-ÀÞ,o>
Üo
1%o
Yo
r	po~
&oO
*%¦DO0 ‘s£

}¤
þ¥
s¦
s§
*0ݒsA

rì"prð"poE
rÒ"prö"poE
rÙprÝpoE
rü"pr#poE
r#pr
#poE
r#pr#poE
r*#pr.#poE
r<#pr@#poE
rJ#prN#poE
rX#pr\#poE
rf#prj#poE
rt#prx#poE
r‚#pr†#poE
€—*V(
}¨
}©
*J{©
{¨
oª
*r(
-rps
z}œ*0“o—(P
->oq
-Er#p(­oo”{É{ão«
op
+op
rW$p(žoo”{É{ÝoÈo«
o’o”{É{Ýo”
oo”{É{árè"po’o¬
(­
o«
oo”{É{àoo’~£
oÖ(®
o«
*0F“oq
-
r¿$p(³*o×(®
(L
,rJ%p(´oM
*0'”--rãprº%psí
z3~¾{Ê{ìo0
+#o{o{È{Ü(Q
(ßs¯

uu	oa
	oa
(®
(°
~ý(±
(·
	

r"&p¢
¢
r(&p¢
	Œ‚¢
r(&p¢
¢
r	p¢
(²
.~š+~›

(Þ{œo³
*0D•-r.&ps
z{œo´

,oÒ,rH&p(³{œoµ
&
*jrš&p(¡{œoµ
&*ž#,@(¶
€š#@(·
€›*
*6þ	s*  *Nouoto*(
*0(c
oi*&o|*0Öoz
 —×ÏÀ(Yov~%
ou&^,v^,q^,l^,f
^,`^,Z^,T^,N^,H	+	•(Y,6X	Ži/		•nj1Þo},ouoto,*X —×ÏÀ7 —×ÏÀYo…8fÿÿÿ
*(y*0#-rÚ&ps
ztsL
oi*(~*{¡*"}¡*^(ˆoþ
~	
(
*(ˆ*{¢*"}¢*{£*"}£*{¤*"}¤*0ø˜{:æ(Žu+
(Žuq(5,U(Œ(4-(Œ(/(Ž(/(
,(Ž(/}8ƒ(Œ(/}+p(5,V(š{Å(-(5,Ooûo¸
oûo
(¡
g
	/	o¹
(º
}+(Ž(/}{*{¥*"}¥*0x(
(4,r±ps
z(
,r
ps
z-rê&ps
z(((‰%-&(‘(”}Ÿ} *Æ(
(((‰%-&(‘}ž*0)G(
{Å(-{Å(-s•*>(™*Bs•*Î{ž-(“(}ž{ž,{ž*r,'ps
z"(œ*š(“-r¯'ps
z(“(+þþ*0`™-r2(ps
zo¬(œ,*o­,6o­o3
+o4

(œ,Þo=
-äÞ
,o>
Ü**2 R
0.šþŒ,þ+(+
Œ(*0h›-r\	ps
zÐ(–
o—
-4(8
(aÐ(–
o˜
¢(9
r\	psc
z(™
t
(*2(š{¿*0Q(Ž(/o»
((/o»
(Œ(/o»
(ˆo¼
(š{¿o¼
*{¿*0ƒœoF
(0
oF
(0oF
oB
-oF
sý

~¦-þ«s½
€¦~¦-oF
s¾
¢(	+(-	s–*0QG(
{È{Ú(Q(-{È{Ø(Qsý
{È{×(Q(-s–*jþþa,*-*oQ
*.(¤þ*0\uE
(¤,*(ŽoŽ(4,5(ˆoˆ(
,"(o(4,(šošþ**2(ŽoR
*(
*b(¿
o¬{p({
*0bžs}

rF(p(Ž(/(¡
oŸ
&rn(p((/(¡
oŸ
&r¢(p(ˆoç
(¡
oŸ
&rÈ(p(š{¿(d
oŸ
&rê(poŸ
&(“9«s?
(“8†	š}prÒ"po~
&~k-
	þ@sÀ
(
+(¿
,7(8
rø!p	{p¢(Á
¢(9
oŸ
&+
	{poŸ
&XŽi?oÿÿÿ+r)poŸ
&%o
(
oB
Yo
oO
*{Ÿ*{ *0SŸ-r’ps
zo”
o{É{Ô{Ê{í{ûo«
o{É{×(/o«
o{É{Òo›oÂ
o«
o’`{É{Ò¢{É{×¢oÃ
{¿oÝ
?šo{É{Ú(/o«
o{É{Øooç
o«
o{É{ÙsÇ(Êo«
o’`{É{Ú¢{É{Ø¢{É{Ù¢oÃ
*0ÏG-r’ps
z-r.)ps
zo”
oÄ,}{¿oÝ
2'o{É{Ô{Ê{í{o«
*o{É{Ô{Ê{í{ûo«
o{É{âoÙoç
o«
*o{É{Ô{Ê{í{ùo«
*0 -r.)ps
zoÂ(Ä
-s^
z{>oÒoÊ(
oÂ(Å
,*oìoÍoÏ(¬r>)poÏ(§+(­r†)poÏ(§*0¢¡-r—ps
z(4,r±ps
z(4,rÕps
zo†sÆ

oÇ
-&(8
(O
	o¢	(9
s•zoÈ
ožoœ((¬{oW*0’sA

rÎ)prY*poE
€¬*(S
*0,¢sD
(³o<(µo>(·oF*FrXp(T
¥h*JrXpŒh(U
*Fr‚p(T
¥h*Jr‚pŒh(U
*Frc*p(T
¥m*Jrc*pŒm(U
*&(;*0`£sÉ

(=rŸ*p(Ao
o
+o§
t"sÁoÊ
o=
-ßÞu

	,	o>
ÜoË
*"%G0b¤(=r·*p(Ao

,rÍ*pr¨poÌ
%(P
,(fs•z(
,
d2 1(fs•z*.(»dþ*0#q(=r×*p(Ao

-*o!
*08q(=r·*p(Ao

,r÷*pr¨poÌ
rÿ*p(
**0ð¥s}

r+po~
&~½ol
+3(m
oÍ
, r++po~
&o~
&rO+po~
&(q
-ÄÞþ0o>
Ü%o
Yo
rà"po~
&sÉ

(=oO
(Ao
o
+o§
t"	sÁoÊ
o=
-ÛÞu
,o>
Ü	oË
	*@^ª)Ó{Ã*’~¶-þÄs

€¶~¶(¿*{Â*’~·-þÅs

€·~·(¿*{Ä*’~¸-þÆs

€¸~¸(¿*0<¦(Æ
oÇ
{s3{rþ3}r
+sH
{t}t*(A*0ÏR{r.;ƒ8«}r{toºoÐ
}w}r+r{woÑ
}u{uoÄoÎ
}x}r+/{xoÏ
}v{v}q}r
Þ8}r{xo=
-Ä(J{wo=
-(I
Þ(FÜ*ÆÆ{q*sØ
z0H{r
YE*{rYE+	Þ(JÜÞ(IÜ*57$@{q*z(
}r(Æ
oÇ
}s*n}r{w,{wo>
*n}r{x,{xo>
*0¦þsH
}t*J(°
(Ô(É*0m	(
(P
,rÍ*ps
z(Ër[+poÒ

/(=sY
zXo
(m
(Ó
(ÍXow
(Ï}¿*0I6(
(Ô

~¾š(m
(n
(¡
(Ë(Ô
(Í(Ï}¿*{Á*"}Á*{Â*"}Â*{Ã*"}Ã*z{¿-~Ë*~Ë~Ì(Õ
*06(°
(Ì
(Ô
(Ö
*J(Ñ(Ð(×
*J(Ì(Ð(Ø
*0>§àg
+%r_+p~Àr_+poB
oÙ
oX
XŽi2ÕsÚ
*0[:(Ò,8(8
(/
(ÓŒ¢(°
΢(9
s•zoÓ-(Ys•zoÔ*0¨uN
-*(ÊoÊ({
*2(ÊoR
*(Ê*0 `
r,p¢€¾sÛ
€À*{Å*0O:-rPps
zo/(Þ,&(8
("
o/¢(9
s/
z{Åo
*:s.(Û*0Ed{Åo
+(


o/({
,Þ(
-ÝÞþ'o>
Ü**'3:(Ýþþ*rdp*`*0'esA
ržp{ÄoE

{Å(ª*0U©-*ržpoz
&{Ä(L
,*(¬o
+o
(Ûo=
-êÞ
,o>
Ü*/I
vrD,p}Äs
}Å(
*:}Æ(
*¢}Æ(
(P
,r0ps
z(é*>(å(ë*B(æ(í*{Ç*"}Ç*{È*"}È*{Æ*^0rôps\
z}Æ*0e:-r`,ps
zŽi(ì1?(8
(#
(ìŒh¢(袎iŒh¢(9
s/
z(ès.*0E(
-rn,ps
zo#(õo$(÷o%(ùo }É*2{ÉsÜ
*0'7(P
,rP"ps
z{Éoz
,**.(PsÝ
z.(PsÝ
z{Ê*"}Ê*{Ë*"}Ë*{Ì*"}Ì*.(PsÝ
z0Cª~Í
+&	š
{ÔoÍ
(
,	{ÕÞ	X
	Ži2Ôr÷ps\
z*09«~Í
+%	š
{ÕoÞ
3{ÔoÍ
Þ	X
	Ži2Õ**V~Ï~Î sc*0x¬oP
(oß
ŽiŽi.7(8
r€,pŽiŒh¢ŽiŒh¢(9
s\
zŽiu
+		‘	‘aҜ	X
	Ži2ë*2((®
*0:­Ži-r'-prº-psc
z‘
1ŽiXuœoà
*F{Ê{ë{ó*F{Ê{ë{ò*F{Ê{ë{ñ*F{Ê{ë{ð*Üù:ˆ9r옚ŢÎ17q~•q»v#sfæ÷Z.'‰‹˜‘Ââzcœ?)¶XÓ²Ê9†Òh7W}EÂçå-ÈzvåΧKH¿ß¯‚Žý%ñNEã‚f4¯Iåµ5̂šH;Šv">]I
%½ÿòû"Ń«0ᮍS
sá
~Ð-þs

€Ð~Ðs¢sâ
~Ñ-þs

€Ñ~Ñs¢sã
~Ò-þs

€Ò~Òs¢sä
~Ó-þs

€Ó~Ós¢€Íuœ€Î u%Ð6(f
€Ï*(
*Æ(
-rÐ-ps
z-rä-ps
z}Ô}Õ*0†¯,+oûoþ
~	
(
-rô-p(­ÝU(õ`rT.p¢rh.p¢r”.p¢~‘(†
o È.ÝÞr¾.p(®Ýñ(	,r0/p(ž8Èo#r¹/poå

	,	(
,rÙ/pr¹/p(¢(
,?ooæ
rT.p({
,(o+(
(
,rO0pr¹/p(¢(
,B,oþ
~	
(
,~‘(†o È.*rÖ0p(­(õs**}}a0z°ooæ
r”.p({
,*ooæ
ra1p({
,Ho+sç
(è

oé
,	oê
3ïoë
rs1p({
,oì
r‹1p({
,**0\±(+oí

+6	oî

r¹/poï
oM
,oð
,oð
(
,Þ	o=
-ÂÞ
	,	o>
Ü**BN
(
*0€(
(o'(-4o(o+((oæ
r”.p({
(*o(o+((.o%(*{×*"}×*{Ø*"}Ø*{Ù*"}Ù*{Ú*"}Ú*{Û*"}Û*{Ü*"}Ü*6((
*0<²(Æ
oÇ
{ñ
3{ò
þ3}ò

+só

{ô
}õ
*(ö
*0c³{ò

E$8G}ò
~ã{õ
r¨po÷
}õ
~â{õ
oø
}ù
(+þ"oú
}û
{ù
oü
9æ~á{õ
{ù
oý
{ù
oþ
oÿ
}
{
oü
9ª}
}
{û
(}
{
{õ
{
oý
{
oþ
oÿ
}
8I{
oý
{û
oB
XX}
{
oý
{
oþ
X{
Y}
~à{õ
{
{
oÿ
}
(+}
8—{
o÷
r•1po	
oü
:ˆ{
o÷
r£1po	
où
}
{
o÷
rµ1po	
où
(

}
|
þ"o
{
{
o
{
o

}
{
oü
:Yÿÿÿ{
}
}ò
*}ò
{
o

}
{
oü
:§þÿÿ*{
*sØ
z*2{
Œ"*z(
}ò
(Æ
oÇ
}ñ
*0´þs

}
*0‚µŽi1Os}
rÅ1po
&
	Ži+	šXrÓ1po
&2ärÝ1po~
&oO

+
(m
rá1p¢¢(9
9s
*0#:(m
r$5p
¢(9
9s
*0Wr'7p9s
€àr:p`
rR	p¢(€ár:p`(€âr:p9s
ۋ*(
*03¶~ä(
, rŒ:pÐW(–
o
s

€ä~ä*~å*€å*V(r¶:p~åo
*V(râ:p~åo
*V(r;p~åo
*V(rD;p~åo
*V(rŒ;p~åo
*V(r¸;p~åo
*V(r$<p~åo
*V(rd<p~åo
*V(rº<p~åo
*V(r=p~åo
*V(r6=p~åo
*V(rl=p~åo
*V(r’=p~åo
*V(rØ=p~åo
*V(rò=p~åo
*V(rF>p~åo
*V(r>p~åo
*V(rè>p~åo
*V(r?p~åo
*V(r>?p~åo
*V(r„?p~åo
*V(rì?p~åo
*V(rD@p~åo
*V(r’@p~åo
*V(r¼@p~åo
*V(rAp~åo
*V(rHAp~åo
*V(rAp~åo
*V(rªAp~åo
*V(rôAp~åo
*V(r6Bp~åo
*V(rŠBp~åo
*V(r¦Bp~åo
*V(rÈBp~åo
*V(rÞBp~åo
*V(rCp~åo
*V(rCp~åo
*V(rlCp~åo
*V(rŽCp~åo
*V(rÎCp~åo
*V(rDp~åo
*V(rFDp~åo
*V(rzDp~åo
*V(r¶Dp~åo
*V(rîDp~åo
*V(r*Ep~åo
*V(rlEp~åo
*V(r¶Ep~åo
*V(räEp~åo
*V(r
Fp~åo
*V(rZFp~åo
*V(r”Fp~åo
*V(rÎFp~åo
*V(rGp~åo
*V(rdGp~åo
*V(r¦Gp~åo
*V(rÐGp~åo
*V(ròGp~åo
*V(r4Hp~åo
*V(r`Hp~åo
*V(r¨Hp~åo
*V(rÒHp~åo
*V(röHp~åo
*V(rIp~åo
*V(r>Ip~åo
*V(rpIp~åo
*V(r´Ip~åo
*V(rÖIp~åo
*V(rþIp~åo
*{è*"}è*{é*"}é*{ê*"}ê*{ë*"}ë*{ì*"}ì*{í*"}í*{î*"}î*{ï*"}ï*{ð*"}ð*{ñ*"}ñ*0O·o3
8+o4

%9þ~7-z	s
%r)p(
%rãp(
%rïp(
%rËp(
%rp(
%r;p(
%rÓp(
%rp(
%rMp(
þ€7þ~7(
,}	E	&/8AJ+Q(h+S(j+J(l+A(n+8(p+/(r+&(t+(v+(x+r4Jp(­o=
:ÊþÿÿÞ
,o>
Ü*A=D
0ø
s±

(g3r)po”
(i3rãpo”
(k3rïpo”
(m3rËpo”
(o3rpo”
(q3r;po”
(s3rÓpo”
(u3rpo”
(w3rMpo”
o¬
*ràp*~æ*0†¹-*}çrÓJpoz
,(P
-sý
(zréJpoz
,g
	,	o½
({rûJpoz
,g,o½
({*0d’sA

(y(
,rÓJp(yoç
oE
rûJprè"p(|(­
oE
réJprè"p(|(­
oE
*~{ç-(%s
z{çs²*0—:(8
r
Kp	
(gŒr¢(iŒr¢(kŒr¢(mŒr¢(oŒr¢(qŒr¢(sŒr¢(uŒr¢(wŒr¢(9
*v--*þþa,*oQ
*.(ƒþ*0:ºuX
(ƒ,*(mŒromŒr(†9(sŒrosŒr(†9æ(uŒrouŒr(†9Æ(iŒroiŒr(†9¦(kŒrokŒr(†9†(oŒrooŒr(†,i(gŒrogŒr(†,L(qŒroqŒr(†,/(wŒrowŒr(†,(yoy(†**v--*þþa,*oQ
*0`
rPLp¢r†Lp¢€æ*(
*0-]sŽ
{Á,o{É{Ñ{Áo“
*0/]s
{Á,o{É{Ñ{Áo“
*Ê(
-r¼Lps
zs¿
(“sA
(‘(•*ª(Ž(
,rÎLps
z(œ(˜*{ò*"}ò*{ó*"}ó*{ô*"}ô*>(’o
þ*{õ*"}õ*J(›(
-**0y»sA

(o
+Oo
(™3+(”{È{Ð(‘
(¡
(’
oE
+(‘
(’
oE
o=
-©Þ
,o>
Ü*[m
{ö*"}ö*0¼(8
rîLp(–Œm¢(9

(o,
o3

+A	o4
(
(8
r&Mp¢(o6
¢(9
(r

	o=
-·Þ
	,	o>
Ü*7M„
~(
s±
( s¥
(¦*{ù*"}ù*{ø*0R½(k
,<(l

(
-(crôpsc
z(l
(Ô
sq
}ø*|øþ*09¾(¥rÎ)poz
,Ð (–
(
¥ s 
*þY*0@	(!
,%(¥rÎ)p("

(m
(
o«
*(¥rÎ)po#
&*{ú*"}ú*0
¿u[
-*(¡o¡(k
(k
3!(k
,($
($
(%
++,*(¥o+
o¥o+
.*(¥o
+o
o¥o&
-
Þso=
-ÝÞ,o>
Ü(Ÿo.
oŸo.
.*(Ÿo3
+o4
oŸoµ
-
Þo=
-ÝÞ,o>
Ü*	*y' Ó'ú2(ŸoR
*0,ÀsA

r\Mp(Ÿ(­oE
(¡(k
,8rxMp(¡(l
(Ô
~÷š(m
(n
oE
(¥o+
>´sV(¥o,
~¬oNoRo3
+ o4
r€
p(¡
oPoE
o=
-×Þ,o>
Ü(¥o
	+,	o

rŒMp(‘
oL(¡
(’
oE
	o=
-ËÞ	,	o>
Ü*Ÿ-Ìå90KÁ-*r\MpoK
-*(Ÿo¼
r\Mpo6
g o½

	
+.	
šoB
1r¤Mp(L
,(Ÿo¾

X

	Ži2Êþ(¢rxMpoz
,9(m
('
,(
3	sq
(¢+rNprxMp(´(¥o(
(8oRo3
+9o4
rŒMp(¡
oz
,oP(¥o«
o=
-¾Þ,o>
Ü*÷F=rÔ
p*`*Vo.
-r¤Mp*(9*0`
r,p¢€÷*0L(<(ArZNprbNpo)
(ArŠNprs1po)
(Ar”Np~º{Ào)
*Js*
(+
(¯*^sç
s,
(+
(¯*0<Â(Æ
oÇ
{‹3{Šþ3}Š
+sZ
{Œ}Œ*(S*02R{ŠE8}Š{Œ(=r¦Np{Œ(Ao
9ˆ{Œ(=r¼Np{Œ(Ao
o
}}Š+?{o§
t"}{{Œs¹}‰}Š
Þv}Š{o=
-´([+O{Œ(=râNp{Œ(Ao
}Ž{Ž{Œs¹}‰}Š
Þ}Š
Þ(XÜ*A)){‰*sØ
z0"	{Š
YE*Þ([Ü*{‰*z(
}Š(Æ
oÇ
}‹*²}Š{u
}{,{o>
*0ÂþsZ
}Œ*0KÃs/

(µo0
o1
-
(¶o0
rôNpo1
Œh(¡(
+(ž*0KÃs/

(µo0
o1
-
(·o0
rôNpo1
Œh(¡(
+(ž*{Ã*0HÄ(Æ
oÇ
{“3{’þ3}’
+sc
{”}”{–}•*(\*0:R{’.;è8}’{”o¹oÐ
}™}’8×{™oÑ
}—{—oÄoÎ
}š}’8Ž{šoÏ
}˜~û-þ½s

€û~û{—oÆ(+&{•{˜o{—oÆ{—oÃ{˜oÿ(—}‘}’
Þ>}’{šo=
:bÿÿÿ(e{™o=
:ÿÿÿ(d
Þ(aÜ*A11{‘*sØ
z0H{’
YE*{’YE+	Þ(eÜÞ(dÜ*57$@{‘*z(
}’(Æ
oÇ
}“*n}’{™,{™o>
*n}’{š,{šo>
*0Äþsc
}”}–*0HÅ(Æ
oÇ
{3{œþ3}œ
+sm
{ž}ž{ }Ÿ*(f*0R{œ.;Â8í}œ{žoºoÐ
}£}œ8®{£oÑ
}¡{¡oÄoÎ
}¤}œ+k{¤oÏ
}¢{Ÿ{¡oÇ{¢o{¡oÆ{¡oÃ{¢oÿ(˜}›}œ
Þ;}œ{¤o=
-ˆ(o{£o=
:Bÿÿÿ(n
Þ(kÜ*A{›*sØ
z0H{œ
YE*{œYE+	Þ(oÜÞ(nÜ*57$@{›*z(
}œ(Æ
oÇ
}*n}œ{£,{£o>
*n}œ{¤,{¤o>
*0Åþsm
}ž} *0HÆ(Æ
oÇ
{§3{¦þ3}¦
+sw
{¨}¨{ª}©*(p*0‚R{¦.;08^}¦{¨oºoÐ
}®}¦8{®oÑ
}«{«oÄoÎ
}¯}¦8Ö{¯oÏ
}¬{«oÂo½-(K{©(­8®{«oÂo¾-(&{©s’z{«oÂo½s¯}­{­{©{«oÇ{¬o{«oÆ{«oÃ{¬oÿ(™}¥}¦
Þ>}¦{¯o=
:ÿÿÿ(y{®o=
:Ñþÿÿ(x
Þ(uÜ*Ayy{¥*sØ
z0H{¦
YE*{¦YE+	Þ(yÜÞ(xÜ*57$@{¥*z(
}¦(Æ
oÇ
}§*n}¦{®,{®o>
*n}¦{¯,{¯o>
*0Æþsw
}¨}ª*0<Ç(Æ
oÇ
{²3{±þ3}±
+s
{³}³*(z*0êR{±.;›8Æ}±{³o»oÐ
}¶}±8‡{¶oÑ
}´{´oÄoÎ
}·}±+D{·oÏ
}µ{µo{´oÆs›}°}±
Þ;}±{·o=
-¯(ƒ{¶o=
:iÿÿÿ(‚
Þ(Ü*áá{°*sØ
z0H{±
YE*{±YE+	Þ(ƒÜÞ(‚Ü*57$@{°*z(
}±(Æ
oÇ
}²*n}±{¶,{¶o>
*n}±{·,{·o>
*0Çþs
}³*0<È(Æ
oÇ
{º3{¹þ3}¹
+s‹
{»}»*(„*0ÏR{¹.;ƒ8«}¹{»o²o-
}¾}¹+r{¾o.
}¼{¼oÀoÐ
}¿}¹+/{¿oÑ
}½{½}¸}¹
Þ8}¹{¿o=
-Ä({¾o=
-(Œ
Þ(‰Ü*ÆÆ{¸*sØ
z0H{¹
YE*{¹YE+	Þ(ÜÞ(ŒÜ*57$@{¸*z(
}¹(Æ
oÇ
}º*n}¹{¾,{¾o>
*n}¹{¿,{¿o>
*0Èþs‹
}»*0<É(Æ
oÇ
{Â3{Áþ3}Á
+s•
{Ã}Ã*(Ž*0ÏR{Á.;ƒ8«}Á{Ão²o-
}Æ}Á+r{Æo.
}Ä{ÄoÁoÐ
}Ç}Á+/{ÇoÑ
}Å{Å}À}Á
Þ8}Á{Ço=
-Ä(—{Æo=
-(–
Þ(“Ü*ÆÆ{À*sØ
z0H{Á
YE*{ÁYE+	Þ(—ÜÞ(–Ü*57$@{À*z(
}Á(Æ
oÇ
}Â*n}Á{Æ,{Æo>
*n}Á{Ç,{Ço>
*0Éþs•
}Ã*0<Ê(Æ
oÇ
{Ê3{Éþ3}É
+sŸ
{Ë}Ë*(˜*0ÏR{É.;ƒ8«}É{Ëo²o-
}Î}É+r{Îo.
}Ì{ÌoÂoÐ
}Ï}É+/{ÏoÑ
}Í{Í}È}É
Þ8}É{Ïo=
-Ä(¡{Îo=
-( 
Þ(Ü*ÆÆ{È*sØ
z0H{É
YE*{ÉYE+	Þ(¡ÜÞ( Ü*57$@{È*z(
}É(Æ
oÇ
}Ê*n}É{Î,{Îo>
*n}É{Ï,{Ïo>
*0ÊþsŸ
}Ë*09Ë(²o-
+o.

o¼-Þo=
-åÞ
,o>
Ü**+
:(6
(À*{ü*"}ü*F(7
(Do8
*0+Ì(7
s@

oK
(^
(JÞ
,o>
Ü*
(
*0J(
(P
,rBOps
z-rPOps
z(É(Ï(Í(Ù(Ë*0ZÍ(P
,rBOps
z-r^Ops
z(Ô
(°
(Ö

Ži(Þ
Þ($r^Ops9
z	*8Fa~Ë*F(Ó(Æ(:
*{þ*"}þ*{ÿ*"}ÿ*{*"}*{*"}*0Î(ÎŽiu
(Îoà
*J(Ê(Ì(Ø
*F(Ñ(°
(;
*F(Ñ(°
(Ö
*0Ïj(Ó
(·
j(<
*0GÐsA

o3
+o4
(¡
o6
oE
o=
-ÝÞ
,o>
Ü(×*
'4
0(ÑoØ
~0ooß
Þ
,o>
Ü*
r(=
(=
 €–˜j]Ys>
*0n•u_
-*o?
(?
.*oÈ(È(L
-&oÊ(Ê(%
-oÌ(Ì(´
,*oÎ(Î(+-**0€Ò(Îs@

~A
sB
(7
(Èo8
Žio‰
o‹
oC

oD
j+	‘naX	Ži2é(Ñ(E
ai*0	 ²sF
€ý*0GÓ~
+*	š
{oÍ
(
,
sâÞ	X
	Ži2ÐrvOps\
z*0:Ó~
+	š
oî3sâÞ	X
	Ži2Ýr–Ops\
z*0CÔ~
+&	š
{oÍ
(
,	oîÞ	X
	Ži2ÔrvOps\
z*0‹Õ-r¼Lps
zQQ~
+_	š
oîZ(­
,
(®
08(­
,
(®
22(üQ,P,{oÍ
QÞX	Ži2š**0sÖ{Ê{ë{ô(
,*~+@š
{oÍ
(
,oîZ(ü(
,
ÞXŽi2¸*	*–(°
(Ä-r°Ops
z}*J{{oÍ
*^{{
(ÎoG
*sH
*F{Ê{ì{ø*sI
*F{Ê{ì{÷*sJ
*F{Ê{ì{ö*s@
*F{Ê{ì{õ*0€×asï
~-þæsK
€~}
~-þçs

€~}sá
}¢sï~-þèsK
€~}
~-þés

€~}sâ
}¢sï~-þêsK
€~}
~	-þës

€	~	}sã
}¢sï
	~
-þìsK
€
~
}
	~-þís

€~}	sä
}	¢€*:{oÞ
[*(
*(S
*FrÊOp(T
t`*6rÊOp(U
*n(L
(P
-(L
(M
**n(N
-*(N
(™
¥"*J(4,*oû*J(
,*sù*&(ø*0\Ø(*(P
,rÔOps
z(-sO
z,oþ
~	
(L
,(0s/
z(ü(þ*&(ú*0_(*(
,rÔOps
zs&
(-sO
z,oþ
~	
(L
,(0s/
z(ü(þ*{H*"}H*{I*"}I*(
*b{Ð~P
(¡
oŽ
*09Ùs¢
}Ð{Ð(P
,*~Gþ£sQ
(+þþ*(
*N{Ñoþ
oM
*0:Ús¤
}Ñ{Ñ(
,*~Gþ¥sQ
(+þþ*0CtQR(ÿ--~S
+~	
~P
(r
RsT
(
Þ&
Þ*6<•no
oU
o
o)
Q*0Ø(*†(
,*oV
-*(-**0¡Û
(+sW

~½ol
	8ˆ	(m
	oX

+S
(Y
o
rÜOpoZ
räOp{Æ([
räOp(r
(\
,o]
(
,+	
(^
-¤Þ
þeo>
Ü(
-	(q
:lÿÿÿÞ	þ0o>
Ü(
,*	oX
+o(Y
o
rÜOpoZ
räOp{Ç([
räOp(r
(\
,3o]
(2,o]
(-+rêOpo]
(­ÞS(^
-ˆÞþeo>
܍`{¢(.
þ
þ(˜**(4`”›¹Ú|VoŠ*0çÜs/

(+(9Ìo,Qos±o(öo³
(+,$	~J-þs_
€J~J(+
	o0
o1
-aoo((¥,8rhPp(ž(ž(+,	oŠ,
o`
+"rºPp(¤+r2Qp(ž+
rŒQp(ž*0@=(ûoa
,(ûoa
oB
-*(ûs&

o(
o)
(.*0ƒ=(+,Q*(ûoþ
~	
(
,(ûsúQ*(ý,<(ûs&

~	
ob
oQ
P3 »oc
o)
súQ*s6Q*0$Ýuq
(4,*(ûoû(
*2(ûoR
*2(ûoç
*0`
rOp¢rYp¢€G*{P*"}P*{Q*"}Q*6sÇ(*V(
((*0Þs0

(-2od
sè
(o¡oì
o?
(®
ÝÎ(sB

	sè
(o¡((,(oÊo»
oì
	oŠ
	oe
oC
ŽiXjof
XԍuœŽi(b
o?
ŽiXof
i(b
(®
Þ	,	o>
Ü,o>
Ü,o>
Ü*(P ð
G³ú
þ
0ß(á

Ži/(Bs•z‘þ9(,}(oÞ
[XŽiYYsg

	oh
	joi
ŽiYŽi/(Bs•z+X‘‘.(Bs•zXŽi2Ú+(9s•zŽiYsg

	sJ
(¢	
,!	(,oF
sÈ

oÕ-	(
	s*2oÒsJ
*roš{¿oÝ
/(**"þþ*0NàoŽoš{Å(-(4,	oŒ
+oŽ
o3sj
ok
-(Bs•z*.rRp€O*{S*"}S*{T*"}T*{U*"}U*{V*"}V*{W*"}W*{X*"}X*{Y*"}Y*0§(
(
,rRps
z-rj!ps
z-r3Rps
z(&(ol
(om
(P
-om
sn
( oo
(P
-oo
+rQRp("op
($oq
((*0}(
(
,rRps
z-r3Rps
z(&(((P
-
sn
( (P
-+rQRp("($((*0:á((!(r
s@

(os
oK
(oH
&*0tâs}

(8
rgRp(%¢(9
oŸ
&(8
r‰Rp
	('¢	(9
oŸ
&(8
r­Rp(Œ¢(9
oŸ
&(8
rÏRp(¢(9
oŸ
&(8
róRp(!¢(9
oŸ
&rSpoŸ
&(#o¦
+Bo§
t`(8
r1Sp¢(#o¨
¢(9
oŸ
&o=
-µÞu
		,	o>
ÜrESpoŸ
&(+oŸ
&oO
*ðO?{\*"}\*{]*"}]*rdp*`*0OesA
ržp(--rYSp+r‡SpoE

(--(/(P
-rµSp(/oE
*0kã-*ržpoz
-*%,.r‡Sp({
-rYSp({
-+(.+(.+*(--rµSpoz
,(0*(
*"(:*{p*b{p3*}p(;*b{q(t
t9}q*b{q(u
t9}q*0ä{q
,s6
ov
*{r*"}r*frÁSp(ð
ty%-&s?*(ñ
*jríSp(T
tK%-&s±*6ríSp(U
*jrp(T
t%-&sw
*6rp(U
*"(:*{u*"}u*08ås
(-(ssý
oo¤toãoç
*00æsý

o]
(^
so
,o
s=**(
*.rÿSp(M*2(}
t~*(~
*>-s
zs€
zs€
z0?ç%(
{‚
oƒ
-{‚
s—o„
{‚
o…

Þ(†
Ü*.60Eç%(
{‚
oƒ
-{‚
s—o„
{‚
o…

o˜Þ(†
Ü*5=0 è%(
(‡
o›
Þ(†
Ü*0!è%(
(‡
o™
Þ(†
Ü*0!é%(
(‡
oš
Þ(†
Ü*0Lê%(
{‚
oˆ
o‰
+(Š

oœ(‹
-éÞþjo>
ÜÞ(†
Ü*4<DJsŒ
}‚
(
*0Lë{~-=%(
{~-$rQTp(¤@u
s¯
oa
}~Þ(†
Ü{~*.>03ì%(
{o
,
Þ{oŽ

Þ(†
Ü*"*0ší%
(
{o
s

{o‘
+(’
oÒ,oŽ
(“
-àÞþlo>
Üo‘
+(’
{o”
&(“
-âÞþlo>
ÜÞ	(†
Ü*(&$J`"‚Š’Js•
}(–
*J   (a*ÿÿÿÿÿÿÿÿÉÚ¢!hÂ4ÄÆb‹€ÜÑ)NŠgÌt¾¦;›"QJyŽ4ÝÍ:C0+
mò_7Oá5mmQÂE䅵vb^~ÆôLBé¦:6 ÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÉÚ¢!hÂ4ÄÆb‹€ÜÑ)NŠgÌt¾¦;›"QJyŽ4ÝÍ:C0+
mò_7Oá5mmQÂE䅵vb^~ÆôLBé¦7íkÿ\¶ô·íî8kûZ‰Ÿ¥®Ÿ$|KæI(fQìæSÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÉÚ¢!hÂ4ÄÆb‹€ÜÑ)NŠgÌt¾¦;›"QJyŽ4ÝÍ:C0+
mò_7Oá5mmQÂE䅵vb^~ÆôLBé¦7íkÿ\¶ô·íî8kûZ‰Ÿ¥®Ÿ$|KæI(fQìä[=Â|¸¡c¿˜ÚH6UӚi?¨ý$Ï_ƒe]#Ü£­–bóV …R»žÕ)p––mg5NJ¼˜ñtlÊ#s'ÿÿÿÿÿÿÿÿ0~î`u%Ð8(f
}‹ €u%Ð9(f
}Œ Àu%Ð:(f
}(N 2/s—
z(m(d*ÿÿÿÿÿÿÿÿÉÚ¢!hÂ4ÄÆb‹€ÜÑ)NŠgÌt¾¦;›"QJyŽ4ÝÍ:C0+
mò_7Oá5mmQÂE䅵vb^~ÆôLBé¦:6 ÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÉÚ¢!hÂ4ÄÆb‹€ÜÑ)NŠgÌt¾¦;›"QJyŽ4ÝÍ:C0+
mò_7Oá5mmQÂE䅵vb^~ÆôLBé¦7íkÿ\¶ô·íî8kûZ‰Ÿ¥®Ÿ$|KæI(fQìæSÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÉÚ¢!hÂ4ÄÆb‹€ÜÑ)NŠgÌt¾¦;›"QJyŽ4ÝÍ:C0+
mò_7Oá5mmQÂE䅵vb^~ÆôLBé¦7íkÿ\¶ô·íî8kûZ‰Ÿ¥®Ÿ$|KæI(fQìä[=Â|¸¡c¿˜ÚH6UӚi?¨ý$Ï_ƒe]#Ü£­–bóV …R»žÕ)p––mg5NJ¼˜ñtlÊ#s'ÿÿÿÿÿÿÿÿ0”`u%Ð;(f
}‹ €u%Ð<(f
}Œ Àu%Ð=(f
}(N,-s
z-sOsO(d*sOsOsO(d*ÿÿÿÿÿÿÿÿÉÚ¢!hÂ4ÄÆb‹€ÜÑ)NŠgÌt¾¦;›"QJyŽ4ÝÍ:C0+
mò_7Oá5mmQÂE䅵vb^~ÆôLBé¦:6 ÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÉÚ¢!hÂ4ÄÆb‹€ÜÑ)NŠgÌt¾¦;›"QJyŽ4ÝÍ:C0+
mò_7Oá5mmQÂE䅵vb^~ÆôLBé¦7íkÿ\¶ô·íî8kûZ‰Ÿ¥®Ÿ$|KæI(fQìæSÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÿÉÚ¢!hÂ4ÄÆb‹€ÜÑ)NŠgÌt¾¦;›"QJyŽ4ÝÍ:C0+
mò_7Oá5mmQÂE䅵vb^~ÆôLBé¦7íkÿ\¶ô·íî8kûZ‰Ÿ¥®Ÿ$|KæI(fQìä[=Â|¸¡c¿˜ÚH6UӚi?¨ý$Ï_ƒe]#Ü£­–bóV …R»žÕ)p––mg5NJ¼˜ñtlÊ#s'ÿÿÿÿÿÿÿÿ0€`u%Ð>(f
}‹ €u%Ð?(f
}Œ Àu%Ð@(f
}(N,-s
z/s—
zsOsO(d*0Æo,B(T(u-4(t-+(q,((T(u-(T(W(r,s˜
z-of}‡}ˆ(p,K{‡(T(W
(c}‰+
(c}‰{‰(t-å{‰(n-×*}‰*0'ï{ˆ{‰{‡o€
omoz*0)ðsO
{‰{‡o€omoz*r—Tp*
*Æ{Š-!{‡oz{ˆoz{‰oz}Š*0Cñþˆ{‡om}›{ˆom}œ,{‰om}*0fò{›-r½Tps™
z{œ-rßTps™
z{›sO
{œsO{,
{sO(d*0oš
Þ(›
Ü*		0q3[ 3{‹sOQ+9 3{ŒsOQ+" 3{sOQ+rUps/
zsQQ*(„QsQQ*(a*~Ž*j /rôps\
z€Ž*~*Z/rôps\
z€*~˜*€˜*~™*€™*0ظ(nog€Ž(noi€(œ
€s
€‘s¿

rOpo”
rYpo”
€“(nokomsž
€”(nooonsŸ
€•(nomomsž
€–(noqonsŸ
€—(noc(t(noe(v*0,óo 

+‘,*XŽiY2íŽiY‘.**~”*~•*~–*~—*F(y(z(*F({(|(*0lôo3

+	o4

(
,ÞL	o=
-ãÞ
	,	o>
Üo¡
+o¢
oo
,Þo=
-âÞ,o>
Ü**!(
:"\(
*ž{Òo£
(},*r%Up{Ò(®*0öõs¦
	}Ò~“	{Òoþ
oµ
-rcUp	{Ò(­*	þ§s¤

	{Òo£
(¥
,Vo 
o¦
..+.‘.‘
3OrÑUpo§
*(x,;rÑUpo§
*rVpo§
*	{Òo
rWVpoÀ
-r[Vpo§
*	{Òo£
(~,r¹Vp	{Ò(­**0möo¨
j2o¨
 ÿÿÿj2(o+(oo¨
i(©

uQoª
+	X/PYo«
%
0çTÞ
,o>
Ü*@"b
0ó(sg
s)*"(„*&(…*>~(†*0“÷
+d(‡o -.'o ..o /.
o 33o'o#ob
sa
+*X(q2”(8
(`
	¢	(9
s¬
z0÷ø(
,rÔOps
z(
,rWps
z(€-)(8
(b¢(9
rÔOpsc
z,7oþ
~	
(
-$(8
(:¢(9
s•z~’,~’o‰*(­
tÈ
o®
(s(¯
io°
(u		(¯
io±
o²
o³
,rè"p(­
o´
,0r7Wpoµ
Žijo¶
r{Wpo·
,o¸
o¹
,oº
Žio‰
Þ
,o>
Üo»
t8(‚Þ,o>
Ü
	o¼
t8,1ol
 ¡3-(‡Þ?(‚Þ2(8
(d

¢
(9
	s”z,o>
Ü*4F
S
iu
[è<CuŸ{¡*"}¡*0W~¾}Ÿ(¾
}ž(Ž,(}Ÿ,r…Wp(
(+(µ*r»Wp(³*.(*.(*.(*.(*.(*.(*0T~¾}Ÿ(¿
rEpÐ
(–
oÀ
t
}žråWpÐ(–
oÀ
t(Ž*J~¾}Ÿ(Á
*þ(Â
rEp{žÐ
(–
oÃ
råWp(Ð(–
oÃ
*š{ž,{ž{Ÿ{È{ÒoK
**0d7{ž,Z{ž{Ÿ{È{Ô(S
,;{Ÿ{Ê{í{ÿ({
-{Ÿ{Ê{í{þ({
***Z(š,*(™,**0å»sA

(š,I{Ÿ{É{Ô{Ÿ{Ê{í{úoE
{Ÿ{É{ÕoL
oE
+G{Ÿ{È{Ô{Ÿ{Ê{í{úoE
{Ÿ{È{ÕoL
oE
{ ,={ o
+o
(‘
(’
oE
o=
-ÝÞ
,o>
Ü*²'Ù
®{ž-*{ž{Ÿ{È{Ò(Qsý
*0ù(
(¤,rãps
z-rEps
z3rûWpoŽ(§+rcXpŒ‹(§(Æ}§(¯(´sA
}¨(³oš{È{áoz
,kg,o½
+Fš(³oš{È{Ð(¡
oz
-~£

{¨	o«
XŽi2²{¨(÷(¶*2{§sÜ
*0'7(P
,rP"ps
z{§oz
,**{©*"}©*
*Ö(³oŽ(³oš{Å(-(4,*(³oŽ*2(³o’*{ª*"}ª*{«*"}«*š{¨(³oš{È{Ò(Qsý
*0hú-r\	ps
zÐ(–
o—
-4(8
(aÐ(–
o˜
¢(9
r\	psc
z(™
t
(¹*0uû(µo¬oû
,o¬o°*o­,Eo­o3

+#	o4
(µoû
,o°Þ	o=
-ÕÞ
	,	o>
Ü**8/g
0uA(µo¬oû
,o¬o¯*o­,Eo­o3

+#	o4
(µoû
,o¯Þ	o=
-ÕÞ
	,	o>
Ü**8/g
0;BþŒ,þ+(+
Œ(º-
þ	**0mü-r\	ps
zÐ(–
o—
-4(8
(aÐ(–
o˜
¢(9
r\	psc
z(™
t
(º-**0Õý-rEps
z(
,r/ps
zrÃXp(
(+(¢
o]
(^
(J~O(S,{E(o
(
	{È{Ô(Q	{Ê{í{ùoM
,	s«*	{Ê{í{oM
,	s«*	{Ê{í{úoM
,4(8
r!Yp	{È{Õo6
¢(9
s•z	{Ê{í{ûoM
,m	{¿oÝ
/1(¤,F(8
(L~O¢(9
s•z(¥-+oŒ(£(¾*(8
(?			{È{Ô¢	¢	(9
s“z0qþ%-&
oš{¿oÝ
/#oš{È{â(S,	s«*(¿(À,{E(Á(Âs«*0>ÿriYp(žoš{È{Ò(Qsý

oþ
oþ
(L
-&o¸
o¸
(L
-o
o
(L
,=(8
(]oš{È{Ò¢¢¢(9
s•zo]
(^
o]
(^
o¦
+_o§
t`
	o¨
	o¨
(L
,=(8
(]oš{È{Ò¢¢¢(9
s•zo=
-˜Þu
,o>
Ü*¼l(0`r—Yp(ž%-&oš{¿oÝ
/}ooš{È{×(Q(-(59(8
(_oš{È{×¢o¢oš{È{×(Q¢(9
s•z(¤-)(¥- oŽoš{Å(-(49Žoš{È{Ú(Q(-
oo7,o9-(:s“zrZp(¦o3sj
ok
-*(8
(F
	¢	(+¢	(9
s•z*0G¨oš{¿oÝ
/*-*r Zp(žoš{È{Ù(QsÈ
oÕ*0Éoš{È{á(Q
g,o½
oš{¿oÝ
?²`oš{É{Ø¢oš{É{Ò¢oš{É{Ù¢oš{É{Ý¢(Ãoš{È{ÚoK
,r`oš{É{Ú¢oš{É{×¢(Ã+8`oš{É{×¢oš{É{Ò¢(Ãoš{È{Ý(Q{E-+{EoˆoÅ

	-rÚZp(ž(Å*	oÒ,/(8
r[poˆ¢(9
oŽs’zr¹[p(žoš	(Ä*0@+3š
(+/!(8
(3
	¢	(9
s•zXŽi2Ç*0@T{È{à(Q
{È{ÐoÖ(®
(L
,(Bs•z*0T(Ö
o×o(,%{E,{Eoˆo×o(oÆ
&o×o)-(Bs•z*0T»sA

o
+/o
(‘
r\poŽ
-(‘
(’
oE
o=
-ÉÞ
,o>
Ü*
;H
ª(®.(Ss
z(±%-&(³oŒ*>(É-*sò*0dsÇ

sÈ
oÉ
&sÊ
oÉ
&sË
oÉ
&2sÌ
oÉ
&sÍ
	oÎ
oÉ
&oÏ
Þ&Þ*S
]Ü2oO
(Ð
*^r\poO
(Ñ
(Ð
*"(Ò
*0:
¢(Ò
*0:
¢¢(Ò
*0:
¢¢¢(Ò
*"(Ò
*2oO
(Ð
*^r\poO
(Ñ
(Ð
*"(Ò
*0:
¢(Ò
*0:
¢¢(Ò
*0:
¢¢¢(Ò
*"(Ò
*2oO
(Ó
*^r\poO
(Ñ
(Ó
*"(Ô
*0:
¢(Ô
*0:
¢¢(Ô
*0:
¢¢¢(Ô
*"(Ô
*2oO
(Õ
*^r\poO
(Ñ
(Õ
*"(Ö
*0:
¢(Ö
*0:
¢¢(Ö
*0:
¢¢¢(Ö
*"(Ö
*2oO
(Õ
*^r\poO
(Ñ
(Õ
*"(Ö
*0:
¢(Ö
*0:
¢¢(Ö
*0:
¢¢¢(Ö
*"(Ö
*2{¬o×
*2{¬oØ
*2{¬oÙ
*2{¬oÚ
*2{¬oÚ
*rr\pr)\psÛ
}¬(
*vsV}¯sÜ
}°(
*0--rEps
zsö
(}­}®{­{È{ÑrWVp(¡
o
	+<	o
(‘
oŽ
,${¯(‘
oB
ow
(’
oM	o=
-»Þ	,	o>
Ü~±og

+I
(h

{¯(‘
oT--{¯(’
oS-{¯(’
(‘
oM
(j
-®Þ
þ.o>
Üo
8õo
(‘
{­{È{ÐoŽ
9Ê(‘
{­{È{ÐoB
ow
rWVpoÒ
2o
{¯oQ%,u{°oÝ
-{°sA
oÞ
/~£
++(‘
{­{È{ÐoB
oB
XXow
{°oß
(’
oE
o=
:ÿþÿÿÞ,o>
Ü*ALJI“«V0Vsö
}­~±og
+!(h
{¯(’
(‘
oM(j
-ÖÞþ.o>
Ü*.F0${®,s^
zsA

{°oà
	8à	(á
(â
(ã

	oå
9½{¯oL-~£
+{­{È{Ð{­{É{ÑrWVp(ä
oE
(¡
	og

+@
(h
(‘
oB
1rWVp(‘
(r
(’
oE

(j
-·Þ
þ.o>
Ü	(å
:ÿÿÿÞ	þro>
Ü*«Mø!ó0¾{®,s^
z(P
,rQ\ps
z-rs\ps
zo+
-*{°oæ
-{°sA
%
oç
oå
1!(8
(1¢(9
s•zo

+	o
(‘
(’
oE
	o=
-ÝÞ
	,	o>
Ü*Œ'³
02’{®-s^
z(P
,rQ\ps
z{°oæ
&*n{®-s^
z{°oÝ
*0-’sA

ràprÉpoE
rÔ
pr‡\poE
€±*&(;*00m(=rÌp(Ao

-
þ*o
s
*F(=o!
sý
*2(?t,*0‹	-*(ooÈ
,*(ÿ(­
,7oÿ(­
,'(ÿ
(®
oÿ(®
(¯
*(ÿ(­
,*oÿ(­
,**0ë
of
d0+~ –0+q È0+d ú0+W ,0	+J ^0+> 0+2 ô0+& X0+  0+ â0+E
 &+/c-**c-***b%*b%*r‘\psè
zr>]ps\
z0Û(
(T(Wol(`
of(`
s‡8‹(b(T(r,æ(s,Üo~(o,*	o‹		(n-9
+&	(p,
+		(](Z	X2Õ
-*X?mÿÿÿ*0“(
(T(Wol(`
s‡+[~%•	oŽ(n-9+&(p,+(](ZX2Õ-*X2 *(
*–s)}Ê(
}És'}È*0M
~½ol
+(m

{¿(é
,Þ$(q
-ÝÞþ0o>
ÜrT]ps\
z*'203
E+~º*~»*~¼*rT]ps\
zÆ-rd]ps
z~¼{È{ÑoK
-~»*~¼*Æ-rd]ps
z~¼{É{ÑoK
-~»*~¼*{Ã*{Â*{Ä*0€-rp]ps
z~Í-þ"s

€Í~Í(+%-K&~Î-þ#s

€Î~Î(+%-$&~Ï-þ$s

€Ï~Ï(+*0)	{¿oÝ

YE+**s/
z0Gu—
-*{¿{¿(é
*2{¿oR
*0>:(8
r]p
{¿oÝ
Œh¢{¿oê
Œh¢(9
*0{s&s
së
}¿rÌ]p}À}Ár^p}Â}Ã}Å}Är>^p}ÆrZ^p}Ç€ºs&ssë
}¿rÌ]p}À}Árz^p}Â}Ã}Å}Är>^p}ÆrZ^p}Ç€»s&rž	p}Ór´^p}ØrÌ^p}Ùrê^p}Ö}âs
	së
}¿	}À	r_p}Á	rB_p}Â	r’_p}Ã	râ_p}Å	rH`p}Ä	rž`p}Æ	rÀ`p}Ç	s)s.râ`p}ôrþ`p}ñrap}òr&ap}ó}ës1r:ap}örRap}÷rjap}ø}ìs2r‚ap}}í}Ê	€¼sì
~¼oí
~»oí
~ºoí
€½~½oî
€¾#@(·
€Ë#$@(·
€Ì*0r\p}Ðrœap}Ñr¢ap}Òr¶ap}Óržp}ÔrµSp}ÕrÌap}×rÞap}Úrôap}Ûrúp}Ür.&p}Ýrp}Þr
bp}ßrbp}àr$bp}ár2bp}ârPbp}ãrtbp}ärŠbp}år˜bp}ær¾bp}çràbp}èrøbp}é(
*0Ær\p}Ðrœap}Ñr¢ap}Òr¶ap}Óržp}ÔrµSp}ÕrÌap}×rÞap}Úrôap}Ûrúp}Ür.&p}Ýrp}Þr
bp}ßrbp}àr$bp}ár2bp}ârPbp}ãrtbp}ärŠbp}år˜bp}ær¾bp}çràbp}èrøbp}é(
{Ñ((}Ñ{Ò((}Ò{Ó((}Ó{Ô((}Ô{Õ((}Õ{Ö((}Ö{×((}×{Ø((}Ø{Ù((}Ù{Ú((}Ú{Û((}Û{Ü((}Ü{Ý((}Ý{Þ((}Þ{ß((}ß{à((}à{á((}á{â((}â{ã((}ã{ä((}ä{å((}å{æ((}æ{ç((}ç{è((}è{é((}é*J-*{Ð(¡
*ús*}ês.}ës1}ìs2}ís3}î(
*Jrcp}ï(
*06`
{ó¢{ò¢{ñ¢{ð¢{ô¢*0-`
{ó¢{ò¢{ñ¢{ð¢*0((+
+	š
,Þ	X
	Ži2ës—z*vr*cp}ðr¨p}ô(
*0-`
{ø¢{÷¢{ö¢{õ¢*0((/
+	š
,Þ	X
	Ži2ës—z*Jr:cp}õ(
*0TrNcp}ùrµSp}úr\cp}ûrjcp}ürŽcp}ýrªcp}þrÔcp}ÿ(
*vrècp}ròcp}(
*{*0T:-rPps
zoè(7,+(8
("
oè¢(9
rPpsc
z{oï
*0F{oð
+(ñ

oè(
,Þ(ò
-ÜÞþuo>
Ü**(4:(6þþ*{*"}*rdp*`*07sA
ržp{oE

(8(
,r¨p(8oç
oE
s¿
s¿
sV
{oð
+s(ñ
	oèoLr¾p(¡
oèoE
rÊp(¡
oì(m
(
oE
oê,
o”
+o”
(ò
-„Þþuo>
Üo
1rþcprè"po¬
(­
oE
o
1rûJprè"po¬
(­
oE
*_€ß0¾-*ržpoz
&{(L
,*r¨poz
&(
,(9rþcpoz
&rûJpoz
&	(>(>o
o
Xs±
oÃ
oÃ
o
-rdp(°*sVoó
8Þ(ô
	r¾p	(¡

oz
9¦	
oMsä
oé	oõ
oërÊp	(¡
oz
,OrÙdp({
, ÿÿÿoí+;
(
,
1
oí+ rÊp	rídp(r
(°+oí(5+rIep	r…ep(r
(°(ö
:ÿÿÿÞþvo>
Ü*½ñ®0Ws¿

(P
,*rWVpoÀ
-
rÙpoÀ
,rŸep(²*g,o½
oÃ
*vrfp}s÷
}(
*0¥(é(M}(ê{>{È{Ü(Q}
{>{Ê{ìo/{
(+/M(8
(?{>{È{Ü¢{
¢(9
{s“
(A} z*0ro
sA
{É{Ö{Ê{ê{ïoE
{É{Þ{Ê{ë{ðoE
{É{Ü{Ê{ì{õoE
*
*Z{>{Ê{í{ÿ*0-(ìo(ìop
{>(Œo{>{É{ÛoÔ(m
(ø
o«
o{>{É{Ü{>oÕo«
o{>{É{ÝoÈo«
o{>{É{Þ{oKo«
{oÎoLo
+'o

o(‘
(‘
o6
o«
o=
-ÐÞ,o>
Ür1fpoÈ(§*Û4(D*03Drcfp
(ÿ(
(8
{
¢(9
(r
*r(
-rãps
z(I*{*"}*2(Ho*0Þ-rãps
zo
{¿oÝ
/!{{È{Þ(S%-&r¨p+{{È{Þ(Q{Ê{ë{ôoM
,sN*{Ê{ëo,(+2sQ*(8
(?
	{È{Þ¢	¢	(9
{s“(A} zÆ(G{oþ
rYpoM
-(-{s“z*Z(J{Ê{ë{ô*0$’sA

(J{É{é(®
oE
*0µ(G{(J{È{Þ(Q}(H{(J{È{ä(U%-&~Ï
(H{(J{È{å(U%-&~Î sc}(H{(J{È{æ(T}
*{*0n(JoK(û{{
(þ
sA
(J{É{ç{oO(ÿoE
(J{É{è(®
oE
*0(UÞ(›
Ü*		z,{,{o>
}*:(U(ù
*{*"}*>(é(X*
*
*(W*:(
(f*sA
*
*0
þ*
*
*
*
*{*"}*Fr÷p(T
t`*6r÷p(U
*(S
*(ú
*si*2t§og*0<(Æ
oÇ
{Õ3{Ôþ3}Ô
+s¯
{Ö}Ö*(¨*0•R{ÔEoU+m}Ô{Ö(û
}Ø}Ô+9{Øo§
t§}×{×og}Ó}Ô
Þ%}Ô{Øo=
-º(°
Þ(­Ü*ŒŒ{Ó*sØ
z0"	{Ô
YE*Þ(°Ü*{Ó*z(
}Ô(Æ
oÇ
}Õ*²}Ô{Øu
}Ù{Ù,{Ùo>
*0þs¯
}Ö*0<(Æ
oÇ
{Ü3{Ûþ3}Û
+s¸
{Ý}Ý*(±*0šR{ÛEtZ+r}Û{Ý(û
}ß}Û+>{ßo§
t§}Þ{Þogs‚
}Ú}Û
Þ%}Û{ßo=
-µ(¹
Þ(¶Ü*‘‘{Ú*sØ
z0"	{Û
YE*Þ(¹Ü*{Ú*z(
}Û(Æ
oÇ
}Ü*²}Û{ßu
}à{à,{ào>
*0þs¸
}Ý*0Þ(É(ê{>{È{Ý(Q(Ë(ê{>{È{à(Q}(ê{>{È{á(Qg,o½
}sA
}{o3
+4o4

{(ê{>{È{Ð(¡
(Ro“
o=
-ÄÞ
,o>
Ü*“@Ó

*Z{>{Ê{í{þ*0ó{>(Œ
(ìo(Ê{{{ooo{>{É{ß-{>{Ê{î{+{>{Ê{î{o«
(ìo(Êor(ê{>{È{ã(S,<(ìooq
	-&r©fp(ªo{>{É{ão«
*(r*07Dr#gp
(Ì(8
{¢(Ê¢(9
(¡
*2{oš*0Œ(
(¤,r°gps
z-rž	ps
z(
,rª	ps
z-r—ps
z}}(„(†(‚oš(ø(~sA
(€*0÷ (4,rÂgps
z-r—ps
z-rž	ps
zo8oo7,	o9&(¾,\o]
,To]
(^

o¦

+!	o§
t`(,
rðgp(­+	o=
-×Þ	u
,o>
Üo…-)(8
(\¢¢(9
s•zo3(x*p-0x!(Æ
oÇ
{ã3{âþ3}â
+sÁ
{å}ä{ç}æ{é}è{ë}ê{í}ì{ï}î*(º*0dR{âE67681}âr™hp{ä(§{ì{æ(z}ðsþ
}ñ{ðo2
}ö}â8â{öo3
}òrip{ä(§rŠip{è(¡r ip{ê(¡}ó{æ{E,U{æ{ò{î(|}ó{ó-0{î,(r¾ip{òoˆ(­{ñ{òo`
+8{ò{è{ê{æsv}á}â
Ý
}â{öo=
:ÿÿÿ(Â{ño1
>ÑrEjp(¬{ñoÿ
}÷}â8Ž|÷(
}ôrip{ä(­rŠip{è(¡r ip{ê(¡{ô{è{ê{æsv}õ{õ}{õ}á}â
Þ(}â|÷(
:bÿÿÿ(Ã
Þ(¿Ü*A[[{á*sØ
z0D{â
YE+	Þ(ÂÜ{âYE*Þ(ÃÜ*:<{á*z(
}â(Æ
oÇ
}ã*n}â{ö,{öo>
*f}â|÷þyo>
*06!þsÁ
}å}ç}é}ë}í}ï*0*"(woü

o=
,oý
*(Qs•z(
*ÂtEoš{¿{øoo<({¿(
*
*0f#sÄ}ø-røjps
z{ø-r—ps
zþÅs
{øo%-&~!-þs€!~!s

o2
+)o3
o,o,
	o
+o=
-ÎÞ,o>
Ü	{øoo
	o
sþ
	o
	+	(
tEo`
	(	
-àÞ	þ{o>
Ü,rkp	o
Œh(¡(¼,,(+,r‘kp(ž+r	lp(ž	(+(ž*}6³æ$
0“$(z
o1
-*{E-r¬lp(žo

*oÿ
+-(
X(|
	,r&mpŒh(¡Þ+(
-ÊÞþyo>
Ürámp(žo
**6:p0>%-r—ps
z(¤,rãps
z{E-*{Eoˆo

,!oošošoÕo?-
,oÇ:Ì9Æ(˜-*oš9®ošoG-#ošoJ,rÂnp(ªošoJošoG
95oš{¿oÝ
?ooš{È{Üo6
ošo$oš{É{Ü(Q(
,Fooš{È{Þo6
ošo$oš{É{Þ(Q(
:–rqopooš{È{Üo6
¢ooš{È{Þo6
¢ošo$oš{É{Ü(Q¢ošo$oš{É{Þ(Q¢(²
,$rLppoˆ(§{Eoˆo

+rppoˆ(³*{*"}*{*"}*{*"}*{*"}*{ *"} *Z(ˆ-{oŽ**š{oŽ{oš{Å(-(4*2(u{¿*{*0?&(…s&

((F{s{{E(,sA
~OoE
(FsA

	(u{È{Ô(,(u{Ê{í{ý+(u{Ê{í{üoE
	(u{È{×{o(/oE
{oš{Á,&	(u{È{Ñ{oš{ÁoE
{oš{¿oÝ
2&	(u{È{Ú{oŽ(/oE
	(u{È{Ó(ƒ(uoE
	(u{È{Òo)
oç
oE
{.F{{{þ(|,	(u{È{ÝoÈoE
+}(}oùo
+o
	(‘
(’
oE
o=
-ÚÞ,o>
Ü{oˆ	s‘{ooW*ã*
ž-r2(ps
z(}o¬o'oú*0GX-rs\ps
zo
+o

(‘
(’
(Žo=
-ÝÞ
,o>
Ü*'<
0Y:(P
,rP"ps
z(oK
,!(8
(G
¢(9
s/
z(%-&r¨po“
*ª(
,(
o…
-(,s
z(‹oØ*Þ(
(
,rìpps
z-r°ps
z(–(”*
*{"*"}"*{#*"}#*J(
s
}$*02'-rqps
z%
(
{$oÈo
Þ(†
Ü**0$(%(
{$o
&Þ(†
Ü*0 )%(
{$o

Þ(†
Ü*0d*%
(

{$o
o
+ (
,oÊoÊ(;
,
(
-×Þþo>
ÜÞ	(†
Ü*-IS[0¤+%
(
{$o
s

{$o
o
+(
oÒ,o
(
-àÞþo>
Üo
+(
{$oÈo
&(
-ÝÞþo>
ÜÞ	(†
Ü*(+$Oe'Œ”œ0%,(%-&(È%-&(Ü
(Ioß*2~%oØ*6~%oÙ*J~%(m
oÞ*6~%oÛ*:~%oÜ*>~%oÝ*2~%oß*6~%oà*J~%(m
oå*6~%oâ*:~%oã*>~%oä*2~%oæ*6~%oç*J~%(m
oì*6~%oé*:~%oê*>~%oë*2~%oí*6~%oî*J~%(m
oó*6~%oð*:~%oñ*>~%oò*2~%oô*6~%oõ*J~%(m
oú*6~%o÷*:~%oø*>~%où*.~%oû*.~%oü*.~%oý*.~%oþ*.~%oÿ*.(€%*{&*:}&(ø*{**"}**{+*"}+*0É-|'(Ä
:­s
}'(Æo†o4
+Ko5

oœ(toz,rqp(Æ(®+(Òo…,s
}'+	o=
-¬Þ,o>
ÜÞ(rÍqp(Æ(¨Þ
rÍqp(Æ	(¨Þ|'(Å
*(/X‡y•‰y©Ÿ{,*"},*{-*"}-*{(*ú(É,.(Ï(5,(Ï(5,(7s
z})}(*{)*0Q(É,.(Í(5,(Í(5,(7s
z}((Ë,('s
z})*0c=(É,(Ï(4,((s
z(Ïu+,(4s
z(Ï(/sT

o(
o)
(.})*{.*"}.*Ò(Ä-{>{Ê{í{ý*{>{Ê{í{ü*0I.(Â
(Ä
,7(Â(Å
,%(É,(Í(5,
(Ï(5****0^/(Ä,r-rps
z(Òs&

sA
{>{È{Ô{>{Ê{í{ùoE
(Fo)
*0Í0(É(ê{>{È{Ô(Q
{>{Ê{í{üoM
,	(Å+a{>{Ê{í{ýoM
,	(Å+:(8
(?{>{È{Ô¢¢(9
(ês“z{>{¿oÝ
2!(ê{>{È{Ú(V})(ê{>{È{×(V}((ê{>{È{Ò(W(Ó(ê{>{È{Ó(X%-&(Ò(t(Ç(ê{>{È{Ý(S(Ë(Æ(Òo…-:(8
(\(Òoç
¢(Æ¢(9
(ês“z{>{¿oÝ
?(Í{>{Å(-(4(Ï{>{Å(-(4a,W(8
(I
	{>{È{Ú¢	{>{È{×¢	{>{Å¢	(9
(ês“z(Ï{>{Å(-(4,"{>{Å,(Ê})}((Ï(5,(Ï(Í(5+(Ì*(®*0ø1{>{¿oÝ
2s^
zsA

{>{È{Ô{>{Ê{í{ýoE
{>{È{×(ÍoO
oE
{>{È{Ò(Òoç
oE
(Æ,!{>{È{Ó(Æ(uoE
(Ê,{>{È{Ý(ÊoE
(ìos&
(Fo)
*0WDr²rp
(Ì(8
(ÄŒm¢(Æ¢(Í¢oî¢(Ò¢(9
(¡
*VsÀ/s€0*s************************************
*
*
*
*
*(
*frÿsp(ð
t²%-&s*(ñ
*jríSp(T
t
%-&s@*6ríSp(U
*jrp(T
t%-&s
*6rp(U
*;‰PNG


IHDRóÿasRGB®ÎébKGDÿÿÿ ½§“	pHYsšœtIMEØ	''È
n»IDAT8˝’»kQ‡¿yìdY%¯ÉÎB*Y‚µ•!&F,l,ìSn'ˆ¥ •eìA[AD	„ þi!Y“,ÙlâÎdg!ÙÙ̝{,"CfŒºäT÷Ü{Ïï|ça³÷‹O‡õZ¯—T`CŽ¬{S¯,<ÿo䃃æÚâìí
Å"ý^ÄQÐÀñWXޚf؛ZȋØg ¹V»;ïÑ<€Ý–‰ÒW°UÀõÉ«Üb‰å-jÀß°¬ªeôX]íóèٛ”îÝË9¹q
Ø.Vó%˜/9­ùø¨Ÿ¹Þÿ©‰"ÁR
þ-pˈhAÄÈvÚ´†Ã¹SxûÄ€°p/}¸HÏmó>K÷qŸxøâ4‹
037@éR‘ø$&IIr‡1w’íúwüöz*62z“o_W²SØßk µFDPJ¡µ¦†lnløí4À
Ëü1F·<€ãÇ'©Ð¸[Á¶mü¶†`„ÖÞîùQ!"h­Ñ:!ìtøQ¯N`š&q#"ˆeÏÃqœÁ	ºÝ0í…ÖšÎá!Á	ÆÜq”R¿wA(W*”J¥ÿ|ùôñ›øøãÍ8=àIEND®B`‚ÕGIF89a¢1c½R{½!cÖsŒ½”¥Æ¹½Ê!ÿNETSCAPE2.0!ù,@ºÁ9—m‚1à½ÙÆuÖnjdqAT‹a®ËrýVølãPˆ‡Äb‡$g=ˆ3zä
3ಒ!ù,?º 9!m‚à½ÙÆuÖnjdqLQTË0®ËrýVølÃÃ`ˆ!Äã"Y\
Å#M”•)$!ù,=º@Đ9W)m!à½ÙÆuÖnjdqŒaTK®˲[¼>Û0€¬ÅcZp<m¶&’H«1§€!ù,@ªUû¯5¨ŒÒ²¬ÅÚÆVq-âHžÏÖQ ¬0 Ë|¬>Ӑ@ ãy…•â`8“€å²ù„H™5Ŕ’!ù,?ªfû¯5È\+®”%mÖÐ=`(:ÆQAœ,àº;hì*Ã@	‚E¯÷yC@ 0‘Ê%óH‘2cŠ%+!ù,=jÌ®©õb„óIZ6™7`	0Ž¦‚¢+Ù¾)Ûºé&A”»Èçy€ø3"“Êâ
ª¼’­!ù,=:öÆEµX{SÛ(œ[GIcŒ(iš©ò­gûÛº  iQ »ÝÈçy€ø3"“Êâ
ª¼’­!ù,?º0Ãp9UmcؽÙÆuÖnjdq‹ Tçºð8¿Õа¸„U
žtŠb°P†F&ÓW‘6{Š)$;úGIF89aÄÿÿÿÙF'ԙÝëð«ÎÛóóót°ÃÍÍÍî¬fºÜ¡L^>ýþý'*­Ï”FJKúÌQ;;;åúÕoopŸŸŸÄê¨üñîûýùúúúIjuååå¹Åɋ‹‹!ù,w  ŽÀ¤LdJ*ƒ¢¾fð¾<“µ}IžªÍ…"䊔@H@ŠK®q(ÁcQ ä"F£().ݯØ
=§kL qdnoM>pEhzsD…~‰ˆE5#‰#˜"›!;ЉPNG


IHDRóÿasRGB®ÎébKGDÿÿÿ ½§“	pHYsšœtIMEØ	+,ÿ?sPIDAT8Ëcüÿÿ?%€‰B@²ه£¥<j+*É2 ûp´á×|+ÿ}å½c!A³Û£ë¿:?åÚ,¦pãI.È>íöí×÷-¯³{tdIÞâgDq(<òÍçw®­þµNJå׆Ù«wˆ‡Â#¿ÿù¶ìÉþ7u9ç¡k†‡AöáhC†$†cSm—.‡iffdYöàÈÇÇ2Š¢sVdajf````üÿÿ?Cø¦àǪB²2lÿ„o½d¼1‘‘}òõ‹w¾ñ3Š–¯ÌZ;
o:øõòkû™Kç¿<ûu]M]hꟿ§Þ¾yç¯È_ù)ø4Ã
XŸºc'+gù“»/ßxv•ááÕÇ_å}å|½ŠP 3"ç…ÀÙ‘ï^¼ŸÅÊÄuWŒ}áúÔÓH2jHÿúÔíĤÆύ,†—Î9r7XIEND®B`‚íGIF89aÄíííááâÊÊÊüüüþiÿkÒÒÒÿöðÿõîÕÕÕÑļðððÍÍÍùùùÝÝÝþcÞÒÊùïèÇËÍÇÇÇýfüx)ÏÒÔ÷õóо´ÿ±‚ÿäÔÝÎÅñòôÒÕ×ýýýÿÿÿ!ù,jà'Ždižè¨eH:ÅÓºBGê-ÁFÀÂS&ÅO!™$€Á 8‘[„`AÁpŸKŒ†Q(´Üâ'àžg%2)z)94–—#!;ʉPNG


IHDRóÿasRGB®ÎébKGDÿÿÿ ½§“	pHYsÒÝ~ütIMEØ	%ώ¤nJIDAT8Ë­“MHTa†Ÿ{½£2
?¡Œ:
èBBܕ‹¨Uˆ´
܈‹ ¢hï¾ÅÐB¤`‹°$iA¢`‹JÓɟRLü¡œÑ¹sgæÎýù¾¯…4ƒ nê,ç}yÞóþ±´“š»“cÊ\™ÇÚÚ@HI°!B8ÖAs_¿vªArúJ¾A¨¥•$˜ÞƒlËñù-4~y¯ß"r¥·¨Ó‰_?¥®½“zÝ%d(Œ€¡ëT»1s“æÃ,>fmjBýÕEƒwÔu]&\a€(‡Ö¨K7Ž0džáÃsꝾŒpŒ`wrL…ZÛ	{ä³ày¨³çŠCê|'‰RŠF;Eh'ÁÌh\	̕yªÊÁP  š™¤Èi¦PÂG	)%µnšOs³¥ÖÖÁº3`À()a»´é­e¤ç€ë‚ð¨‘>ëK‰R!%dLȤÀLA:	ß>
äâÒ±‘¾ƒ'$žPä
n‰ ØÁJ~§:—])à`íñ”S@íl@!‡*ä±%l
ƒšHæWŽ±ö¥~DIBæÕԆº‡£¨ØE¤'/À°j—íê.Ehîë×öƒmOGši¤™Bæ­Ò+TÉû‚¼€¯N€åÊn>|¤;¤¦ÞÛ|Ζ±é*„uˆ˜~…ÿ…{Wɼ}Fփ…B€—ûUô|ÊkSja|„ÐN‚Z/Mµ°q…â§0X³u–+[é¢w`@;õ3͌ÆÕêÜ,ëK	r—šH”hWwû¿Ö‡Q%ÜèØIEND®B`‚~(ÎÊムlSystem.Resources.ResourceReader, mscorlib, Version=2.0.0.0, Culture=neutral, PublicKeyToken=b77a5c561934e089#System.Resources.RuntimeResourceSetEPADPADPsŠîä
9҉6ÆŠÎE‹ØÔAŒôÞü–5bޛӝœ»¸a 5 ¢6Z¤¦h‚§Ñ¤[°Ú@´Tr€¸ØÀ™5°Â@Æ>Ä°Ë{ÆTõɼŒÊãÕAËACÌ
β¦Ó3ÔoÔ$Š×S•àöã?à‚ãÎã¿ÕÇêèì}ìX;þÕ®Ö°ûƎ
XÜ
.k–
ûr8}S·H#†´&cøo+'Ѩ/áâº7H$‰:Kù¥=Í?u’öAº’´D·¨´Dý··Eë^ÙH–DQ鑴U|f„Vï"àWMº_YqCK^´µKa¹ºÅa倁d3Šåf>íärã²îså:vìOkxˆ„yPÒe•Æ}!eЁ
Úf¦—[½•
û
Ä	ç%	à1P
Ž
í¼
Hž
,´I
/ç
Â
u`úľHJ	u¹+é@Ów€:ÃŒB
NÁו	)*AttributeAlreadyAdded,AttributeTooManyValues:2BadAssociationPrivateData†*CIDVerificationFailedFCallDeserializeBeforeCreateResponseCjClaimedIdentifierCannotBeSetOnDelegatedAuthenticationœ>ClaimedIdentifierMustBeSetFirstTClientScriptExtensionPropertyNameCollisionIDClientScriptExtensionTypeCollision”4CreateRequestAlreadyCalledÆ4CurrentHttpContextRequired$EncryptionRequired{DExpectedBase64OpenIdQueryParameter	ExpiredNonceORExplicitHttpUriSuppliedWithSslRequirementøHExtensionAlreadyAddedWithSameTypeURI0VExtensionParameterKeysWithoutPrefixExpected¯"FieldMustBeSigned0FragmentNotAllowedOnXRIsiDHttpContextRequiredForThisOverloadfIAssociationStoreRequiredWhenNoHttpContextAvailable÷VIdentifierSelectRequiresMatchingIdentifiers™LIncompatibleAssociationAndSessionTypesò(InconsistentAppStatecBInsecureWebRequestWithSslRequired}	FInvalidCharacterInKeyValueFormInputÓ	FInvalidKeyValueFormCharacterMissingA
InvalidNonce¦
HInvalidOpenIdExtensionParameterValueÑ
@InvalidOpenIdQueryParameterValueRInvalidOpenIdQueryParameterValueBadBase64EInvalidScheme‡ InvalidSignature¸InvalidUriÜ&InvalidXRDSDocumentInvalidXri!NIssuedAssertionFailsIdentifierDiscoveryF KeyAlreadyExistsï>KeysListAndDictionaryDoNotMatch
2MatchingArgumentsExpectedL
BMinimumOPVersionRequirementNotMetŠ
2MissingCanonicalIDElement:MissingInternalQueryParameterg6MissingOpenIdQueryParameterš:MissingReturnToQueryParameterÎ@NoRelyingPartyEndpointDiscoveredHNotSupportedByAuthenticationSnapshotn,OpenIdEndpointNotFoundì$OpenIdTextBoxEmptyNOperationOnlyValidForSetupRequiredState#8PrefixWithoutPeriodsExpected8ProviderOpenIdVersionUnknown¼4ProviderRespondedWithErrorì^ProviderRespondedWithUnrecognizedHTTPStatusCode!@RealmCausedRedirectUponDiscoveryh(ReplayAttackDetectedÝ ResponseNotReadyÿ@ReturnToArgDifferentFromQueryArgs*ReturnToNotUnderRealmÚFReturnToParamDoesNotMatchRequestUrl(SregInvalidBirthdateZ"TamperingDetected• TooManyRedirectsæ$TypeMustImplementX70UnsafeWebRequestDetectedUBUnspecifiedDateTimeKindNotAllowed– WebRequestFailedÖ&XriResolutionFailedô4XriResolutionStatusMissing8An attribute with type URI '{0}' has already been added.JOnly {0} values for attribute '{1}' were requested, but {2} were supplied.”The private data supplied does not meet the requirements of any known Association type.  Its length may be too short, or it may have been corrupted.$XRI CanonicalID verification failed.WA Simple Registration request must be deserialized before CreateResponse can be called.xThe ClaimedIdentifier property cannot be set when IsDelegatedIdentifier is true to avoid breaking OpenID URL delegation.1The ClaimedIdentifier property must be set first.IAn extension with this property name ('{0}') has already been registered.0The extension '{0}' has already been registered.IAn authentication request has already been created using CreateRequest().hHttpContext.Current is null.  There must be an ASP.NET request in process for this operation to succeed.‹An encrypted session using either HTTPS or Diffie-Hellman is required when establishing associations between relying parties and providers.DOpenID parameter '{0}' was expected to be base64 encoded but is not.¦The nonce has expired.  It was good until {0} (UTC), and it is now {1} (UTC).  If this looks wrong, check the server's clock, time zone and daylight savings settings.6URI is not SSL yet requireSslDiscovery is set to true.}An extension sharing namespace '{0}' has already been added.  Only one extension per namespace is allowed in a given request.hExtension parameter key '{0}' encountered, but extension parameter keys should not include their prefix.NThe OpenID parameter '{0}' must be signed by the OpenID Provider, but was not.2Fragment segments do not apply to XRI identifiers.XNo current ASP.NET HttpContext was detected.  Use an overload that does not require one.ŸNo current HttpContext was detected, so an IAssociationStore must be explicitly provided. Call the Server constructor overload that takes an IAssociationStore.WClaimedIdentifier and LocalIdentifier must be the same when IsIdentifierSelect is true.oThe Provider requested association type '{0}' and session type '{1}', which are not compatible with each other.—Inconsistent setting of application state.  Authentication request was sent with application state available, but authentication response was received without it available.  This makes it impossible to validate the token's signature and will cause assertion verification failure.TInsecure web request for '{0}' aborted due to security requirements demanding HTTPS.lCannot encode '{0}' because it contains an illegal character for Key-Value Form encoding.  (line {1}: '{2}')cCannot decode Key-Value Form because a line was found without a '{0}' character.  (line {1}: '{2}'))The nonce was not in the expected format.>OpenID extension {0} parameter {1} had unexpected value '{2}'.2OpenID parameter '{0}' had unexpected value '{1}'.@OpenID parameter '{0}' with value '{1}' failed to base64 decode./The scheme must be http or https but was '{0}'."The signature verification failed.#The value '{0}' is not a valid URI.Failure parsing XRDS document.#Not a recognized XRI format: '{0}'.¦The OpenId Provider issued an assertion for an Identifier whose discovery information did not match.
Assertion endpoint info:
{0}
Discovered endpoint info:
{1}#The given key '{0}' already exists.6The list of keys do not match the provided dictionary.<The '{0}' and '{1}' parameters must both be or not be '{2}'.ŽThis Relying Party requires a Provider that supports at least OpenID version {0}, but Provider is detected to only support OpenID version {1}.JThe XRDS document for XRI {0} is missing the required CanonicalID element.1Query parameter '{0}' was missing from the query.2OpenID parameter '{0}' was missing from the query.@Query parameter '{0}' was expected in the return_to query '{1}'.\No XRDS document containing OpenId relying party endpoint information could be found at {0}.|This operation is not supported by serialized authentication responses.  Try this operation from the LoggedIn event handler.No OpenId endpoint found.No OpenId url is provided.hThis operation is only allowed when IAuthenticationResponse.State == AuthenticationStatus.SetupRequired.-Prefix should not begin or end with a period..Unable to determine provider's OpenID version.3The OpenId Provider responded with an error: '{0}'.EThe OpenId Provider responded with unrecognized HTTP status code {0}.sAn HTTP request to the realm URL ({0}) resulted in a redirect, which is not allowed during relying party discovery. The nonce has already been used.rOpenId provider's response is not ready.  Use IsResponseReady to check, and fill in the required properties first.eThe '{0}' parameter does not have the same value for return_to ('{1}') and the regular query ('{2}').&return_to '{0}' not under realm '{1}'.VThe {0} parameter ({1}) does not match the actual URL ({2}) the request was made with.9Invalid birthdate value.  Must be in the form yyyy-MM-dd.OThe '{0}' parameter was expected to have the value '{1}' but had '{2}' instead.OThe maximum allowable number of redirects were exceeded while requesting '{0}'.The type must implement {0}.?The URL '{0}' is rated unsafe and cannot be requested this way.>Providing a DateTime whose Kind is Unspecified is not allowed.Web request to '{0}' failed.XRI resolution failed.GCould not find XRI resolution Status tag or code attribute was invalid.BSJBv2.0.50727lPù#~¼ùµ#Strings¼®4t#USð"#GUID#$g#BlobW߶+	ú3ßÔøÅ*´È1qô¦
B"

¥ž¬ž
Æ±Ûž
í±
ž
ž
ž0
žW
:
k
žu
ž
ž
‹
±í
‡h‡}æÚ&í
åí
_:
MžXžŠkîÞÝÈõõ—ž"žL#žY#ž,$ž¶&¥&õ&š&Ê(í
ø,ž	/í
÷2ž‹ñ396.677 77Ð7í
9ž";}-;}ä1žD:
REBEÆFk1GGiGXGWXí
ï[š&dõ6fž9i(i’iõ1kkCkkRn?n£v„vnzOz’}žԃƒíƒÂƒ„ƒ!„ƒ@„ƒY„ƒr„ƒ„ƒ¨„ƒÁ„XGㄞù„Oz
…Oz;……s…W……W…ž…õµ…?nOɅ؅…ø……†?n/†…J†ž`†žx†.6†žª†.6ú†?n‡?n,‡žC‡žU‡}b‡}{‡í
ч7î‡}ˆžˆž@ˆ}YˆÚrˆžƒˆž§ˆž
¯ˆ±ΈžՈž눞ûˆž‰ž+‰žD‰žI‰ža‰ž뉅ú‰ž­ŠÚæŠÍŠ-‹žF‹ž‘‹{‹ª‹{‹׋hð‹.6_ŒžjŽ?n“Ž‚ŽÀŽž֎š&ûŽž“*õM.6
q±
‘±
͏±
ð±

±+k=kLkgkmk}ž™š&›ÈӐž&“š&M“¥&f“¥&·”ƒŔ}۔ñ3ú”õå•7“Ȑ÷–:
¬š:
ºš:
Ț:
֚:
"›}4›š&^›GXœ7Žœvœ¥œ?nýœžÈ/¥&Æ¥žá¥:
ï¥:
ü¥:

¦:
ã§:
î§:
ù§:
,¨ž‰¨Gü¨õ1©žB©OzY©Ozj©Ozz©Oz’©Oz¥©Oz©:
Þ©žö©‚Ž“	ªȐ&«:
=«õc«(iz«(iò«ß«:¬õ·¬õü¬Oz­Oz/­?n\­L­j­W…z­W…‘­L­«­W…À­W…Ù­W…ì­W…ÿ­W…®W…'®W…R®L­d®?n¯ž	¯ž*@]	 j]ƒ]˜§Á§' Ó]*Þ]:ï
@.9!JC	'‡H+‡T-“_-˜¡fq-¬¡‰q-®¡œq-°!»Ê-±¡õ]:Õÿ]:Ù¡*>ä€*>é§D,§O¡=§O¡UqO'guO)ª§	R;ÀÉV;ܧ[Cîu	^LqdL]gW*ˆj]3qk_Dla_]ts€e§yŒs§œ|•„*~›¢°‚ !Ú] …¯èÉx‹Á÷	‹É€**\ŽÉ¡<]Í¡P§Ò¡\§Õz§œÕ ‹Ø¥ ³°‘, Ã§“3Ù§“4ò] “6#”=8Éx•B€D]•D€L]–IQ˜gX˜kj*šm€t‡t¡‡zć¡Ô§¡æ§…ü§ˆ€*§¬€u§°…'ª°…<­±…N°±a
³±Éx¶¹Œ]	¹Ç¨]¼Ç®°ÄÚ»°Æä ̧Éïë]ÍûýÔÉÖ	É×€ÉÝ$]ä,Êæg :]ò‰E*!òŒWu÷žfÉxû¯s]%ü¾ƒ]ýÁ]ýÄœ]|ݯ°ð‚Ëð‚Òð‚Þð‚ãð‚ëð‚õ ð‚ý!ð‚&ð‚,ð‚2ð‚8ð‚">ð‚(Að/
Fð!K] GõYÊ	Ke§O k]R€°Z-€Ê^6…Žn6–§$p6³s>Ã*$uD¡Ü#vGð#vI€	ÉvL€	)zL"	Ê	zU)	]}UB	§~\Y	j		€`z	ø‡`	]Žn£	šˆ¡·	§šŒ€°šÜ	-› é	]1ž¡ù	§¢ž
§	¢«%
§§«<
¬È H
]­ó \
]­õp
]­öŠ
Éx²þ•
]	²¢
j	¶°
j	¶¡ù	*¶¿
]	¶Ï
]ºØ
Ð&è
ê)÷
ï*ð+õ/#ù2)37°4Du@s*\
@€[*Gk*ˆ
N„*ˆ
Q¡*\W¯§]Ì
gâ9jz*¸oû§	u§u+§"‘B]$—€O]%V*¸&€e]/Ûv1܁1s‰3¸‰-AƒŒAåIŒ-Uõ’-U„“U­•\'ÿ•])N–f2Œ–n;²–o=k—p?Œ˜qAâš-yK›yKM‰S͞‘\m ›f¡¥p»¡°zk£¸„Û¤ÀŽP¥È˜­•Ð¢k—Ѥª-Ò¦Jª-Ò¦|ª-Ò¦ «Ò¦¯Ó¨°Ú±N±áº€³øÄQ€ª
;Ú
¶â
»¿æ"÷%PšU´»ÎZT–V€\™V€b™V€k™Q€œ;1®Å1ÃÅ1ïÉ.™¯'Í+ç¿D"S€‰–S€¥–S€Ã–á–(–Q€·;Q€Ì;Q€ó;Q€;Q€ÐyQ€Ü;îyõÐ6úÐu5T–V€‚žV€‹žV€ž™§§@;aK1S£;é‰m;‡;ž;¸¬Ð;ì;;;ÀÖïÏ
U} n¿ ¿Í}Ö ú Q€ª
;…!÷»‹!¿‘!¶™!
} u!"„Õ"ØÎÜ8Œ„ %ÍÊ%Öí%ÖT–V€Y&ïV€d&ïV€y&ïS€&;S€Œ&;;'_	Q'd	m'h	+(½	?(Â	\(Ç	T–V€Œ(Þ	V€¢(Þ	V€©(Þ	V€°(Þ	V€·(Þ	!¾(;×(í	é(í	Q€˜);Q€°);¿)–*P%*dQ€7*;Q€R*;Q€d*;Q€*;Q€Ÿ*;Q€¸*;Q€Ñ*;Q€ï*;Q€ß,;-»µ-ãÜ-"8ŒÆHÍ+翯'} +(½	¬.ãÅ.UÎ.»8ŒØ!!;/'È/»Q€0;Q€0;3.0Å! 0;Ê0;ç0;T–V€ä1tV€ë1t2;} ²ù3ûg4;€4Ö¿4.!} u8ŒÆHS€^5;127í	÷7Êû7Î18Ø18Ø08ÝL:;Å.UN;¢;î;»<.8<.[<.„<ã8ŒŽPS€í;S€C>;S€\>;S€€>;S€™>;3¥>¿S€À>;S€Ë>;S€A&;S€á>;S€î>;S€÷>;Q€ó;Q€;Q€?;8ŒØ˜Øe˜ØT–V€mA‡V€sA‡Q€xAyQ€A;1ŸAãB"RB^À;{Bj™B;!!;/' C–g4;BC"iC¿8<.§C;ÕC‰íCŽ+D7DšØe˜ØQšØ…šØˆDØ#DãS€šD;ÌE»èE»F»&F7CF;aF"Q€ÓFBQ€ÙF;Q€áF;1îFS1õFS1üFS1GSyG©…G‰1•Xã¨X;mû‡ûžûÀXû¸ûÐûìûûûÛX»Z¿ZDšU4Z;`Z»1ŸAãÙZKy[Ö™[¿¦žØ:]5›]j“^;«^jÃ^Øä^_ å_Y L¦^ €¦Ø´¦^ è¦Ø§^ Q§Ø†§^ »§Øg^Øz^^ ò_ãV€"	;V€"`;V€q;V€‚;V€,`;V€H;V€2`;V€9`;V€?`;V€D`;V€K`;V€R`;V€^`;V€g`;V€v`;V€{`;V€`;V€B;V€Œ`;V€–`;V€›`;V€ `;V€§`;V€«`;V€¾`;V€Ñ`;V€Ö`;V€i;V€^;V€«`;V€¾`;V€Ñ`;V€Ö`;V€i;V€^;V€Ü`;V€à`;V€ä`;V€è`;V€î`;V€õ`;V€û`;V€a;V€	a;V€a;V€a;V€ a;V€*a;V€5a;V€Ca;V€Qa;V€Ya;V€ba;V€ka;V€ta;Q€|a;1óaã‚b»—b"…šÁWT–V€ÜbûV€ûV€æbû6îb;WcÛ1´+Q€nc;.d!2Nd&F7jd;ÖÌE»‹d»Q€Ød;Q€äd;0e"Ke;S€‚e;S€Še;S€”e;S€£e;S€¼e;S€Çe;S€Ðe;S€Ùe;S€âe;S€èe;S€ñe;S€õe;S€üe;S€f;S€
f;S€f;S€f;S€$f;+f"Cf4˜f4Q€Æf;Q€áf;/g"V€tg;V€yg;V€g;V€„g;T–V€f5V€$f5ég 5hh45T–V€#h>5V€,h>5V€0h>5V€7h>5V€<h>5V€Fh>5œh§ h§¤h§¨h"³h¿hÌhi–i–LiŽ5_iŽ5~i“5«i£5¼i£5Ëi´5ßi£5îi´5gj؉jØS€í;Þjàjâj¿Ï
Uk¿¯k.T–V€êl‰V€ól‰V€úl‰V€m‰m¿(m¿ÕC‰Í+ú ^nÐ7Å.Uèn"ónß7oä71oí	T–V€{o%8V€€o%8V€˜%8T–V€Èp4V€Ìp4V€Ðp46ÔpU6ØpU6ÜpU6àps86QaU9£8 q;-q;Kq;kq;†q;˜q;¹q;Òq;&êq¨8&ñq¨8­8úqØrؘؚØe˜Ø2`;@r;Cr;_;Mr;Rr;Xr;cr;lr;xr;‡r;’r;r;¨r;µr;Âr;Ër;Ïr;Ör;år;÷r;s;	s;s;-s;9s;As²8Ks·8îh¼8!Á8ÝÆ8Ws;„s;Œs;–s; s;ªs;Ús;äs;ðs;üs;t;Rr;t;t;(t;6t;Kt;Ut;bt;gt;!!;mtË8È/»S€{o;V€t;V€¢t;V€®t;r;Âtõ:Í}
uu½	u;8u`u.;Q€{u;ùu;v¿vÖT–V€ppX;V€vX;%vï;v+ý'Ö Pw¿nwX;„wà;›w»è¦Øx¿`Z»0xñ;Sx<kx0<‰x0<Òx.âx.y"„wà;7y"[y"‚y»6¯y7<6´y<<Q€Æf;Q€áf;׉â?ᒱJ“ÍJ›ÌRéœýS6ª[hª[šª[®ª[ª[Öª[êª[þª[«[ÿŒÊˆ–“–p||EӍ|Eݍ„EíÊøEÿŒzJˆ–“–{¿ߑ¿ë‘ß7þ‘;
’zJ’– ’"0’;B’…JÿŒ)Kˆ–“–C”4KM”_	X”9Kø>KÀ•"ÿŒÊˆ–“–õ} M
– Mþ}¨M–¨M*–Ê5–EÿŒÊˆ–“–õ}õM
–õM]–úMh–9Ks–>K~?N"~"~—;ÿŒùQˆ–“–C”RH™4KV™ùQ`™	Rh–RÿŒÊˆ–“–;;’›;œ›,S¨›;¶›,SÛ;Λ;ڛSæ›,Só›–œ–œ,SœÊÿŒRˆ–“–C”CUM”_		ž_	ø9Kž>KÿŒ+ˆ–“–C”CUß.¶Ÿ.ȟ4K֟ùQàŸ	RùŸRÿŒ+ˆ–“–C”CUâxŠUž ŠUµ 4KÄ ùQÏ 	Rê RÿŒ+ˆ–“–C”CUå{•U6¡•UR¡4Ka¡ùQl¡•U…¡	R ¡RÿŒ¼Uˆ–“–C”CU·¢4KÆ¢ùQÑ¢	Rì¢RÿŒ4Kˆ–“–C”CU9¤RD¤4KS¤ÞUn¤	RÿŒ4Kˆ–“–C”CU¥R¥4K¥ÞU5¥	RÿŒ4Kˆ–“–C”CUl¥Rw¥4K†¥ÞU¡¥	R-;-»-»ÿŒ;ˆ–“–C”a»¯”aX”9Kø>KÿŒSˆ–“–C”aÒ°”a`™9Kà°>KÿŒVbˆ–“–å{.6¡.ãy'-²'ü{à;?²à;|»J²»qƒab[²abSƒ"q²"”²ab¤²jbŲ+Ô²Â	æ²+õ²Vb³tb`™~bãy'P ƒ¾
©X Ì
¯a ƒÇi )Ír “6Ôy “RÔ€ “›Ù‡ †¬Þ² †¬âÄ ¬ô`!ƒ²
h!¿q!ƒÌy!Ù‚!†ÿ)
¨!.
"†3
X"–5?ì"‘NÔ,#“mJÆt¬ÆŽ·3#†¬ÞB#†¬ÍQ#†üÓY#Íd#æt¬”#†tØè$掷´&‘‹i˜5ø&„¬íl(„aüt(r}(„ƒ…(
Ž(…–(¦Ÿ(„Ǭ(†¬í·(†D!Þ(†9H!)„¬T!%)…†H"-)¤T"6)–ÂY#C)–Â_$V)–Âf%i)–ÎY&“)–Ôl'«)–Ýt)Ãóy*½)–üƒ*Ø)–ƒ,ä)Æ‹.í)Ɛ/Ã)”/Ã6™/õ)ƒ¬T0!*†ö1)*†¯12*†=2:*†V¯2D*ƒo´3r*†¬Þ5|*†1`5À*†HH5Ò*†WT5å*†ff6÷*†‡l6
+†ö7+†¯7/+†=8A+†V¯8T+†¬Þ9q+†¬Ô9”+†¬Û;È+†¬á< ,–Îè>ð,†¬î?è-†¬ô@H.†¬úAt.†¬ÿB¶.–ÂC¾.–Â
DÕ.–ÂEÝ.–F/–Hv/–!J/–!&L–/–!N¡/–,-P¹/–,RÄ/–8Te0–8-V’0–D-X›0–Q-Z¤0‘y9\¼0–>\|1–
^Œ1†‹F_H2†‹Þ`X2†•`¨2†žL`Ø2†žQa3†¦úb%3†­úc03†¦Vd3†¶f¼3†Ã\fS4–üafz4–ah¤4–ühjÊ4–hló4–Ìhnÿ4–Ûhp5–çhr5–ýht)5†pv25†ww@5†|xÐ5!Þz 6†+ÞzL6Ɛzy6ÆDzƒ6Æ‹z¹6†1‚{Â6†5‚|Ì6†@‰}è6†GH07†GQh7–W’€„7–i
 7†xނlD‘‹i˜5‚ˆD†¬Û‚ÜD†¦Ûƒ F†·‰„ØF†À‰†qG†Ë‰ˆ˜G†Ï‰ŠŒH×‰Œ´I†Ë«ŽJ×«ÐLÏ«’hOÞ‚”ôPì‚•XR–ù³–{R–—¤R–¸™8T–œNT†¬ޞVT¬ޞ`T–žtU– HV–$¢$W–,¤<X–ʦèX–3&¨8Y–K&ªtY–TÓ¬ÐY–]Û®HZ–iä°è\–y-² ]–ƒ-´D^–ŽÓ¶¤^–·î¸D_–žýÀ`–²
Éb–1˼b–5&Íc–5ÏÆ
ÁDÑÆ
ÍÑÆ&ÑÆ1ÒÆ'>Õd†¬ÞØ$dƒ¬WØFd†°DÙNd†½WÙWd†ÊDÚ_d†ÔWÚhd†ú\Û£d†
DÛ«d†WÛ´d†$aܼd†2jÜe†@DÝe†QWÝye†btށe†m~ފe†xDߒe†‡Wߛe†–Dà£e†¢Wà¬e†®Dá´e†»WáÀe†ñâ f†ý’âuf†	Dã}f†Wã†fá	#DäŽfá	Rä˜fá•&äôgáÊ1åHi‘˜è|iá>êüj–üžík–žï(kÆ‹ñl‘b¦ò*l‘‹i˜5ôÆ
ÒôÆ
,×ôÆ
8\ôÆAÞô<lƒ¬ëô‘læ	Òø™lXøø¢læ	,×ùªlaþù³læ	8\ú»lmîúÄlƒvûÌl‹
ûØlæAÞü mƒ 
üÆ
THüÆ
h(üÆu-üÆŠ3ýÆŠ9ýn„¬Eþkn„¬ÿsn¶ÿ|n…ƒK„nEÃÀDn„ÉP•nàVžn„÷P¦n V°n“% ]o“5 g<pæ	C fÆ
THÄ[ Sp„j Þ\p†hr qá	† ((qæu-Dq² wØqæŠ3 ræŠ9œrÆDËr“RÔÒr“›ÙÙr†¬Þÿr†¬s¬¨s†5 )às†5 6t†5 AHtƒ®!Iätƒ®!Z uƒ®!i(v“½!t\væ!Hœv†hyüvƒ"~w†/"w†A"—§x–S"¢Èx‘l"¬Ny†”"³Vy†§"¸`y–5¾ôy†Ì`üyÙÄzº"Ëz“mÒ!$w‘ŒD!†¬#ÆE#%Æg#$&Æs#0)Æ}#6*Æ‘#+ÆŠ3+ÆŠ;+Æ
¦#”,Æ
¼#D,Æ
Ý#B,Æ
è#H,Æ],Æi-z†¬Þ05z†5$v0=z†R$€0Fz†o$‹1Nz…$“1Wz†›$‹2_z·$“2hzÆ‹3œ{Ɛ4¬{áÓ$]4¬|á%i5Ñ}á	#D8Ø}á	R8à}“=%œ8è}‘O%¥9D~“c%±;Ð~“w%œ<H“‘%½=e„¬1	>Œ„¬:	@¬„Å&A	A´Î&:	A½„×&G	BŁæ&L	B΁„	'R	Cց"'X	Cà†¬~	Dƒ¸'ÞH<…†Î'	HD…Õ'–	HM…†Ü'	IU…ì'£	I`…ü'ª	J¸…†(°	KÀ…(¶	K̅†û(6L††)ö	MX††
)ü	O‡†)Q ‡†:)6Rć†G)6Sö‡†W)Tˆ†c)
T$ˆ†o)
ULˆ)6V¢ˆ†¬ÞẄÆÒ)UWÀ‰‘Ù)]X(ŠÄê)UYŠÄ*UZ\‹†¬Þ[P‹‘‹i˜5[d‹†¬¯[ˆ‹ÆÒ)U\Œ†¬Þ]¼‹‘‹i˜5]Œ“mr]7Œ†¬Þ]KŒ†
+x]]Œ†"+~]pŒ†7+x^‚Œ†C+~^•Œ†O+_§Œ†f+¯_ºŒ†}+`̌†•+¯`ߌ†­+…aúŒ†À+‹a†Ó+…b#†æ+‹b1†ù+…cL†,‹cZ†),…du†A,‹dƒ–¿e–ÂÆf¨–ÂÎgȍ†¬WhˆŽ†¬iƒ¬Õj‘-Ük5†-Hl=1-TlF†D-DmS†M-Dm`†X-mm†a-Dmz†r-Dm‡ƒƒ-
mƒ•-
mԏƒÈ-HmVƒÓ-
mdƒÓ-çnô‘ƒóío˜’Æ‹pԒƐqð’ÆDqµ‘1¿Hq<“‘‹i˜5rԝ„¬ír|ž„ƒu„ž
už„Çvšž…v¢ž¦v«ž„aüw³žrw¼ž„g.x
Ÿ¬~	xŸ†Î'	|%ŸÕ'–	|0Ÿ–s.ø}¨Ÿ–s.„¡†h„¢†¬„¢†z.
†"¢“.†4¢†LJ+¢‘µÐI‡¢†#/1ˆ˜¢†2/;ˆô¢†?/B‰X£L/
Šg£†^/H‹u£†u/
‹}£†ƒ/‹†£á	#DŒ£á	RŒ˜£á•&Œ죓‘/I¥áÊ1¸¨“¥/[’਑»/±“€©†¬ޔž©ƒ¬W”¨©ƒ¬÷•ªƒC0D—$ªS0W—-ªƒc0D˜5ªt0W˜>ª“…0t™|ª‘0ýš¨ª±0
›ت½0›«Ãóy›$«ƒó›2«Ã)”œ5«Ã6™œT«Æ‹„«Æž‘«ÆDžª«‘‹i˜5ž«†¬žÌ«†&1 Ü«†.1% ¬†;1- \®†K17 |®†\1A ¯†p1” T¯æŒ1F Ó¯„¬E¡ܯƒò1D¢䯃2W¢ð¯ÆD£ÆS2y£Æd2‚¥Æd2Š¦Æs2“¨Æ…2ÞªÆ
ž2\ªÆ³2šªÆÁ2Þ«/°¬í«<°–s.¡®´±†h¶±Æå2À±Æå2ŲÆë2Ì´Æë2Ó¶Æë2Ù¸Æë2à»Æë2è¿Æ3ÀÂÆ3ÅÃÆ3ÌÅÆ3ÓÇÆ3ÙÉÆ3àÌÆ3èÐÆ3ÀÓÆ3ÅÔÆ3ÌÖÆ3ÓØÆ3ÙÚÆ3àÝÆ3èáÆ'3ÀäÆ'3ÅåÆ-3ÌçÆ-3ÓéÆ-3ÙëÆ-3àîÆ-3èòÆ93ÀõÆ93ÅöÆ?3ÌøÆ?3ÓúÆ?3ÙüÆ?3àÿÆ?3èÆ
K3HÆ
^3HÆ
p3HÆ
‚3HÆ
•3H᱁¬ð±“4²‘4
4²‘'4E²æå2ÀS²æå2Åb²æë2Ì
v²æë2Ó…²æë2Ù•²æë2৲æë2è·²æ3ÀŲæ3ÅÔ²æ3Ìè²æ3Ó÷²æ3Ù³æ3à"³æ3è&)³æ3À)7³æ3Å*F³æ3Ì,Z³æ3Ó.i³æ3Ù0y³æ3à3‹³æ3è7›³æ'3À:©³æ'3Å;¸³æ-3Ì=̳æ-3Ó?Û³æ-3ÙAë³æ-3àDý³æ-3èH
´æ93ÀK´æ93ÅL*´æ?3ÌN>´æ?3ÓPM´æ?3ÙR]´æ?3àUo´æ?3èY´æ	K3H\Œ´æ	^3H\™´æ	p3H\¦´æ	‚3H\³´æ	•3H\À´ƒ¬Þ\Ô´ƒ¬W\µ†¬]5µ†ÁD_=µƒE4W_Fµ†Q4‹`Nµ\4“`ÆŸ4aXµæŸ4c$·†¬Þe,·ƒ¬2eP·ÃóyfX·Ã)”fj·Ã6™fx·ÆDg…·Æ‹g“·Æh ·ƒ¬8h½·†¦#DiÏ·†¼#DiÜ·†Ñ4Hi췆à4Di
¸†¬>i¸†5Dk$¸–5Hkܸ–5Rl츖+5Xm|¹–;5Üog¹‘•¿Hpº–o5~qTº–‡5‚q º–§5r»–Ç5Ùs`»–Þ5Ùs¬»–û5˜s¸»“6Ôsô»–F6¡s¼–]6ªuð¼–l6ªwH½–Š6ªy|½–™6µ{Ô½–®6µ}0¾–Ã6Á¾–Ü6́ð¾–î6Ùƒ€¿“7æ…ð¿–&7ð‡XÀ–Q7ý‰äÀ“h7ûŠÁ“x7ŒtӇ7&Ž˜Ã“Ó->”Å“¬7Q’´Å“³7^“Ɠ¹7e”@Ǔv–qǓˆ—4ɓ“˜`ɑ‹i˜5š†¬šÆE#£œÆg#ªÆs#µ Iʆ¬¼¡_ÊÆD£rʆ¬ç£Ê†Có¤ ËÆ68ú¥ôËÆ=8©(ÍÆd2«xÍÆO8 ­“Í‘‹i˜5¯»ÍÆ	Z8(¯¾ÍÆ	i8.¯ÌÍÆ	{8¯Ó̈́“84¯Æª8:°ç̈́¬Þ±ðÍÄÚ8L±Îƪ8:³Îƪ8L´çÎÄí8S¶êΆ¬Þ¸ôÎÄÚ8L¸#φ¬ÞºÆÿ8ZºÆÿ8_ºÆ
9eȮ
5
Ȯ(9
Ȯ
99%¼Æ
M9%¼+φy9
¼3ρŽ9¼<σ£9H½TÏá	°9
½\φä9”½dρÿ92½mφ¦#”¾uρ:2¾~φp1”¿†Ï0:2¿Ï†¼#DÀ”Іi:AÀœÐŽ:qÀ¨Ð¬wÁ,с¬È`ѓ³:žÍ•Ñ“Ï:´Ò¥Ñ“Ï:ÌضцÇßêÑæ(9
ßóцÿ8
à҆ÿ8æá˜Òæÿ8ZâÔÒæÿ8_âHÓá	ê:eãXӃìãÀӓóäPԓ8;üå­Ô–ü
çÈԖ
éÔÔÆ‹ë<ÕƐìlÕÆDìÚÖá	^;%ìâÖá	®;%ìµÓ‘Y—…Pìì֖è=íLؖ>(ñ(ٖ>2óÄٖ(>;ôtڑ‹i˜5øÚ†¬Þø¨Ú†1øàچöøòچ¯øۆ=ùۆV¯ù*ۆ4?Hú<ۆV?TúOۆ¬Vû\ۆ–?`ýØہ£?ýF܆¿?HýT܆Ý?Dý„܆í?HýÈ܁@jýè݆ @`þކE@`þBކi@`þ„à†@-þàݑ¼—ÐIþ
ޑç—ÐIÿ:ޑ8˜ÐI¡àƒ¬Þ´àƒ¬÷0წK…á†DáƒXW–ჺASžáƒËAX§áƒÜAD¯áƒïAW¸áBx	Øáƒ)Bx	ýá†1BH	â†?BS	$â‘\B~	pâƒsBc	ØâÆ‹
ãƐãÆDã‘‹i˜5Dã†#/1Lã†2/;§ã†2/¸ã†?/BäL/
+äá	#D2äá	R<äáÓ$]päá%iä䆬Þ冬Þ冬W:冬÷J冬s[å†ÁDcå†E4Wlå†CHtå†CT}å†&C…å†0C¯ å†:Cz惬8eææ‘#tææ}#6§ææŠ3 ³ææŠ; ¿ææ	¦#”!Çæ:2!Ðææ	¼#D"Øæ{CW"áææ	Ý#B#é恜C‚#òææ	è#H$ç–D”$Pç–Dž&•ç–CD¦(¬ç–WD¬(0è–hD»,@è‘yDÁ-AꆬÞ.Té‘‹i˜5.†è‘šÐI.˜è‘7šÐI/ªè‘DšÐI0¼è‘xšÐI1IꆬÈ2|ê–ó4 쑥D6¨ì–´D7 톬Þ8(톬8´í†ÜD
;¼íëD;Åí†úD
<ÍíE<Öí†E
=Þí0E=çí†^E*>ïínE0>øí†~ED?EW?	EH@ET@EHA$ñ–
GADñ‘=G›BÔñ‘HG£Dò‘‹i˜5Egòƒ¬ÞEpò“•G®E¯ò“ñ´E¶ò“ý¹E¾ò“©G~FÔò“ÃG~Fêò“ÞG~Fó“üG~Fó“$H~F,ó“>H~FBó“xH~FXó“œH~Fnó“ËH~F„ó“òH~Fšó“I~F°ó“0I~FÆó“GI~FÜó“nI~Fòó“I~Fô“­I~Fô“ÖI~F4ô“J~FJô“J~F`ô“9J~Fvô“`J~FŒô“˜J~F¢ô“ÈJ~F¸ô“óJ~FÎô“K~Fäô“2K~Fúô“ZK~Fõ“‚K~F&õ““K~F<õ“¼K~FRõ“áK~Fhõ“L~F~õ“!L~F”õ“6L~Fªõ“EL~FÀõ“]L~FÖõ“lL~Fìõ“˜L~Fö“­L~Fö“ÑL~F.ö“ïL~FDö“M~FZö“3M~Fpö“UM~F†ö“uM~Fœö“—M~F²ö“¼M~FÈö“åM~FÞö“N~Fôö“N~F
÷“CN~F ÷“dN~F6÷“…N~FL÷“¤N~Fb÷“ØN~Fx÷“ýN~FŽ÷“O~F¤÷“+O~Fº÷“PO~FÐ÷“jO~Fæ÷“’O~Fü÷“«O~Fø“ÁO~F(ø“ÖO~F>ø“íO~FTø“
P~Fjø“0P~F€ø“EP~F–ø“]P~F¬ø†°ÊF´ø†½ÐF½ø†ÊÊGÅø†ÔÐGÎø†
ÊHÖø†ÐHßø†$ÊIçø†2ÐIðø†bÊJøø†mÐJù†xÊK	ù†‡ÐKù†–ÊLù†¢ÐL#ù†®ÊM+ù†»ÐM4ù†	ÊN<ù†ÐNEù†;X
OMù†IXOXùƒeX×PÐúXäRŸûá	#DS¦ûá	RS°ûá%iSDüáÓ$]V´ü†[ ìWÔüÆDWwý–üñW•ý–ñY¤ýÆ‹[êþ‘b¦\2ÿ†¬Þ^ÿ‘‹i˜5^Æ
Y^Æ
Y^Æ
#Y
^<ÿ–MY^xÿ–bY_³ÿ¬Íbæÿ¬'c†yYf„Yf"†Y1g*šY:g3†Çh;)ÍhD†¥YHiT†¶YDi\ÕYWieæ	Yjxæ	Yjæ	#Y
j†ôYj$ÆDkІ¬Þkð†³Z‹køÆZ“k†ïZal†	[jll†#[Um´†:[_m†Q[ne[nÆ‹oHƐpXá•&p¬áÊ1qá	#Dtá	Rt#“=%œt<‘‹i˜5u`†¬:	u¸†¬tvˆ¬Ww4
†ù[{xT
ƒ	\…x¬
ƒ	\y¬
 \’zHE\…{TE\|°ƒo\ž}쁒\`}(«\`}dÉ\`}„ƒÞ\H}‘{žÐI}܆¬
~ë†"]ó.]
üæt¬€æŽ·X†¬ނ`„¬²‚¸–¾†0‘[]ɉ7ƒ€]H‰I†¥]D‰Q°]W‰Zƒ»]SŠbƒÆ]XŠk„Ñ]x‹så]~‹|…ù]\Œ„^†^\¹†*^SÌ†1BHÞ6^xð…M^ύÃg^ӍƒCÚŽx…CØ‘Äz^듼‘‡^ñ“ÜÆ‹”X Ɛ•ä ‘‹i˜5•!–s. •\!–s. š¤!–¨_% žô!“¸_-  Œ"“Ï_C ¦#¬L ©1#Ãg^Ó­D#Äz^ë®Ä#‘‹i˜5®\#‘5¦úV®d#‘s¦ÐI¯v#‘§¦úV°~#‘Û¦ÐI±#‘§úV²˜#‘D§ÐI³ª#‘y§úV´²#‘®§ÐIµP%ƒ`¶_%†¬Þ¶g%†¬Þ¶o%†–aD¶%†£aW¶%†°aF1·«%†ÄaK1·Ç%–ÂW1¸Ú%–Â_1¹í%ƒ¬Wºø%ƒ¬÷»`&ƒ¬½l&ƒ¬g1¾×&ƒ5
Àß&bÀè&ƒ
bHÁð&(bTÁ'‘Fbt€'‘Fbn1ÃÈ'‘Vbt1Ä((‘Vb1ÈD(“fbtÊ\(“fbn1Ë€(‘qb‰1Ì`*ÃóyÎT+Ã)”Π+Ã6™Î0,Æ‹Ï`,ƐÐm,ÆDÐX*‘¢¨ºWÐ|,‘‹i˜5Ѧ,†÷b’1Ñ®,†c˜1Ñ·,†²Ò¿,¿
ÒÈ,†¬
ÓÖ,¬Ÿ1Ôì,†©1Ö4.–°1×P/‘cº1Ù]/‘cÃ1Úz/‘,cÍ1Ü„/‘=cÔ1ÝÞ/‘‹i˜5Þê/†…cû1Þò/˜c2Þû/†«cÒß0ºcøß0†^E*à0nE0à0†ÉcDá%0ÝcWá.0†,×â60aþâ?0†ÜD
ãG0ëDãP0†ñc
äX0þcäd0†¬2å1ƒ¬2è¤1†dDïì1ÆDï|3†ðdHï„3†þdTï3†eDð•3†eWðž3á	#Dñ¥3á	Rñ°3á•&ñ4áÊ1òƒ4†¬Þõ‹4ƒ¬Þõ”4†HHõœ4†WTõµ4 ƒUf4öÎ4 ƒkf4÷è4„fÞø5†ffø5†‡lø5“mJù65†¬Þù>5†ñf/4ùY5†g54ùg5†g<4ú‚5†%gL4ú5ƒ¬Þû™5ƒ4?Hû¡5ƒV?TûÆ5 s4üÆ^gz4ÿ¬5æ5 s4ð5æ^gz4,6†¬Þ46–s.¦@6–s.ú4M6†¬Þƈg\Æšg5Æ­g5ƾg5	U6ÆÏgW
e6ÆÝg5l6ƒûg,5È6æS2y
,7æd2‚h7æd2Š¨7æs2“è7æ…2Þ\8†¬Þp8æ	ž2\Ø8æ³2š(9æÁ2Þø9†¬Þ:†¬ÞÀ;†¬H5ð=†¬Q50@†¬[5¼@4d5Aƈg\#ÄAƚg5#ùAÆOhD$BÆhhD$BÄhT$8BÆ­g5%ˆBƾg5&üBćhÞ',Chp5'©C‘mr+°C–O+~5+·C–f+‚5+ÒC–}+~5,ÙC–•+‚5,ðC–
+É-÷C–"+‡5-ÿC–7+É.D–C+‡5.D‘‹i˜5/ôD‘œiœ5/,E–­+«503E–ù+½50:E–Ó+«50AE–),½50HE‘jt0ZE‘jt1lE‘&jÇ520F‘3jn154G‘BjÙ56ÀG‘Kjå59æG“ð5;ïG“ø5<ùG“6>H“6A¬H‘Wj6F†¬MÆE#H6OÆg#T6RÆs#c6WÆ
¢j”XäJ†äj”XìJój2XøJƒ¬¤6Y[Kƒ¬³6]gKƒ¬À6`sKƒ¬É6cKƒ¬Ð6e‹Kƒ¬Û6g—Kƒ¬Wi¤K„¬â6jLƒ¬ÞlLÆ@Tkâ6lWLƒbkHn€LrkHnðLá	†knMæ	YnNæ	#Y
nÆlnÆlö	oÆ!lì6qÆ.lÞrÆ
Àò6rÆ
Alø6rÆ
Jl(sÆ
bl
sÆ
rlÿ6sÆ
¦#”sÆ
|lHsÆ
ƒ7sÆ
“les8Nƒ¬7sSOæ‘#v`Oæ}#6v“Oæ	Ý#Bw›OœC‚w¤Oæ	è#Hx§Oæ	¦#”xÝOæ	¼#DxêOƒƒxòO
xûO†÷PyP VyPƒ8m
z4PƒEm-7z¨PƒEm37{<Q² 97|ÐQæŠ3}RæŠ;}”R“Î?7~xT‘^mP7‚øT‘qmg7ˆTV‘€mv7‹ÀW‘¨mˆ7X‘ºm˜7’ìY‘Êm§7•8Z‘àm¯7—„Z‘ým˜7›äZ‘nÁ7žT[æ	¢j”Ÿ[“4Ÿ[‘jn
Ÿ\æå2ÀŸ\æå2Å 5\æë2Ì¢@\æë2Ó¤`\æë2Ù¦„\æë2੬\æë2è­µ\æ3À°Â\æ3űÚ\æ3̳ä\æ3Óµ]æ3Ù·(]æ3àºP]æ3è¾Y]æ3ÀÁf]æ3ÅÂ~]æ3ÌĈ]æ3Óƨ]æ3ÙÈÌ]æ3àËô]æ3èÏý]æ'3ÀÒ
^æ'3ÅÓ"^æ-3ÌÕ,^æ-3Ó×L^æ-3ÙÙp^æ-3àܘ^æ-3èà¡^æ93Àã®^æ93ÅäÆ^æ?3ÌæÐ^æ?3Óèð^æ?3Ùê_æ?3àí<_æ?3èñE_æ	K3HôR_æ	^3Hô__æ	p3Hôl_æ	‚3Hôy_æ	•3Hô†_†¬ÞôƪnÕ7ôÆÀn
õÆÒnÐ6ö£_¬ÞøÄ_–"oó7øLb–;oÿ7ùÀb†To8údæÒnÐ6ûèdæªnÕ7ý&eæÀn
þDe‘‹i˜5ÿ}e†¬>ÿˆe†.1%Äe†5
Öe†go8äeæŒ18†¬ÆE#*8Æg#38Æs#0
|f‘oA8tg–oJ8
\h–­oJ8ûh†¬ÞÆ
C fÆ
¿oHÆ
rlÿ6Æ
ÍoHÆ
|lHÆ
éoHÆ
pӮ
p2Æ
¦#”Æ
:2Æ+pWÆ
HpS8Æ
\p[8i¬l8,i–D}8˜i–D†8×i“ìp8	j“óp8Tj“ìp›8àj†qfkÆ‹BkƐPkÆD;j‘Ò®ÐICj‘ß®ÐIKj‘ì®ÐIœk‘‹i˜5$n†¬Þ4o†¬l8r6r6 r†¬Þ!Xr†¬Þ!lr†gsA!°r†osA!ìr†·sD! s†¬Þ!@s†gsA!|s†·sD!°s†¬Þ!Äs†¬Þ!$t†¬Þ!Bt†#/Õ8!Lt†2/ß8!¬t†?/æ8"uL/
#u†u/
$'u†ƒ/$0uá	#D%7uá	R%@uáÓ$]%”vá%i&px‘tí8)Óx†¬Þ*ôx†¬E*¨y“Êtú:+&zÆTH,)zÃ
ÀD,@z†åt;,Œ{Ä[ ,”{ÆD,Ó{„¬E,ð{„ƒK-ø{E-|„Ç.Æ
ìtD.Æåt;.|–üt;/ú|†¬E0,}ÆìtD1D}Æåt;1t}†¬E25~ÆìtD3@~Æåt;3¼~ćhÞ4ì~hT4æhÞ5†h5"+u
5+ƒ¬;6;Ã
ÀD8>ÆTH8AÄ[ 8I†¬(;8Xæ‘#9_æ}#69dæŠ3:zæŠ;:}æ	¦#”;€æ	¼#D;ƒæ	Ý#B;†æ	è#H;ŽRu(;;—†ŠuD<©†“uW<·†¬Þ=¿†¬Þ=ÇĜu;;=ÎÄ­u@;=„ƒ»u>PƒƒÍuF;>pƒ†¬E>l„ÆTH?o„Ã
ÀD?ˆ„ƒåt;?‡…Ä[ ?…ÆD?ӅDvÇ?à…¬];?x†“s.k;C€‹‘Qv;Hċ“`vš;N8Œ‘mv©;Rȍ‘¸v½;TxŽ‘ÇvÍ;V„ÉPYʐàVYӐ„ÖvZېçvZäæ	Àò6[ìæ	Alø6[õæ	rlÿ6\ýøvÙ;\‘æ	bl
]‘w]‘æ	¦#”^.‘æ	|lH^U‘æ	“le^b‘á	w7^l‘æ	Jl(^ȓæ!lì6^ð“æl_T”ælö	`¹”æ.lÞb3Œ‘´³¨bb䔆¬å;c•æ	Ye•æ	Ye'•ÿwe0•æ	#Y
f8•ôYfA•†¬ÞgT•†7x£	g¤•†;xü;h䕆?x
i –†·s	j¬–†FxÞj„—‘Zxjµ—–å2<j—–å2
<kЗ–ë2<mã—–ë2<oñ—–ë2!<q˜–ë2(<t˜–3<x˜–3
<y+˜–3<{>˜–3<}L˜–3!<[˜–3(<‚k˜–3<†x˜–3
<‡†˜–3<‰™˜–3<‹§˜–3!<¶˜–3(<Ƙ–'3<”Ә–'3
<•á˜–-3<—ô˜–-3<™™–-3!<›™–-3(<ž!™–93<¢.™–93
<£<™–?3<¥O™–?3<§]™–?3!<©l™–?3(<¬|™–K3
°ˆ™–^3
°”™–p3
° ™–‚3
°¬™–•3
°¸™‘‹i˜5°ęæ	HpS8°̙æ	\p[8°ۙæ	¿oH±ã™{xT±ì™æ	rlÿ6²ô™øvÙ;²šæ	ÍoH³›æ	|lH³›¡xT³›æ	éoH´›¸xT´"›æ	p”µ*›æ	p2µi›æ	¦#”¶t›æ	:2¶ԛæ+pW·Cœƒ8m
¸Kœôx¸TœÃ
ÀD¹ŒœÆTH¹äœƒy
¹Pƒ¬E¹) Ä[ º4 ƒy
º8¡ÆDº›¡‘‹i˜5º±¡“4º¸¡æå2Àºº¡æå2Å»¼¡æë2̽¾¡æë2Ó¿À¡æë2ÙÁ¡æë2àÄÄ¡æë2èÈÆ¡æ3ÀËÈ¡æ3ÅÌÊ¡æ3ÌÎÌ¡æ3ÓÐΡæ3ÙÒСæ3àÕÒ¡æ3èÙÔ¡æ3ÀÜÖ¡æ3ÅÝØ¡æ3ÌßÚ¡æ3ÓáÜ¡æ3ÙãÞ¡æ3àæà¡æ3èêâ¡æ'3Àíä¡æ'3Åîæ¡æ-3Ìðè¡æ-3Óòê¡æ-3Ùôì¡æ-3à÷î¡æ-3èûð¡æ93Àþò¡æ93Åÿô¡æ?3Ìö¡æ?3Óø¡æ?3Ùú¡æ?3àü¡æ?3èþ¡æ	K3H¢æ	^3H¢æ	p3H¢æ	‚3H
¢æ	•3H
¢†¬Þ¢“mÒ/¢†¬Þ7¢†ñf@<R¢†gE<`¢†gK<{¢†%gV<|ᚌx=ÄáҌÞCÌá݇H°€á	‰=¸€áBÞÀ€ámÞá	¨N?
†¬¯,ŽÞ°¥á‘oJø¥áҌÞC¦á݇H$¨á	q‘J,¨áBÞ4¨ámÞt¨á	¨N?|¨†¬¯›¨M’Þ”¬á›“KܬáҌÞCä¬á݇H¸­á	ð“.KÀ­áBÞÈ­ámÞ®á	¨N?®†¬¯/®ŽÞ\¿†¬Þd¿†Î•ùLÄÁᚌx=ÂáҌÞC Âá݇HÜÂá	‰=äÂáBÞìÂámÞ,Ãá	¨N?9Ƭ¯XÁ@–ÞìÃᚌx=4ÄáҌÞC<Äá݇HèÄá	‰=ðÄáBÞøÄámÞ8Åá	¨N?Eņ¬¯dŁ~–ޙƆ¬Þ¤Æ†¢–NNzdž¬Þ„džȖOIՆ¬ÞQՆ—ÄPhÞᢘîQ°ÞáҌÞC¸Þá݇H¤ßá	ö˜þQ¬ßáBÞ´ßámÞ$àá	¨N?,à†¬¯Kàk™Þgày™Þ(îᚌx=pîáҌÞCxîá݇Hçðá	‰=ïðáBÞöðámÞøðá	¨N?ñ†¬¯äác8U,áҌÞC4á݇H	á	·˜	áBÞ 	ámÞà	á	¨N?è	†¬¯
žÞáøžyU`áҌÞChá݇HÌá	XŸÔáBÞÜámÞL
á	¨N?T
†¬¯s
ëŸÞ
 ÞÐ
áøžyU$áҌÞC,á݇Hhá	XŸpáBÞxámÞèá	¨N?ð†¬¯Û Þ+ö ÞláøžyUÀáҌÞCÈá݇Htá	XŸ|áBÞ„ámÞôá	¨N?ü†¬¯‘¡Þ 7¬¡Þ xá塱U ÀáҌÞC Èá݇H Ðá	O¢ÁU ØáBÞ àámÞ Pá	¨N? X†¬¯ wÝ¢Þ!“ø¢Þ!Ðá‹£ÓU!áҌÞC! á݇H!á	ã£8!áBÞ!ámÞ!Œá	¨N?!”†¬¯!³_¤Þ"ρz¤Þ"á‹£ÓU"TáҌÞC"\á݇H"Há	ã£8"PáBÞ"XámÞ"Èá	¨N?"І¬¯"ï&¥Þ#A¥Þ#Há‹£ÓU#áҌÞC#˜á݇H#„á	ã£8#ŒáBÞ#”ámÞ#á	¨N?#†¬¯#+’¥Þ$G­¥Þ$ù&†¬Þ$'†¨
$a'†¬Þ%i'†B¨
%F†¬Þ&F†³«
&Üá5¯†a'$€áҌÞC',€á݇H'à€á	y¯D'è€áBÞ'ð€ámÞ'0á	¨N?'8†¬¯'WŽÞ(¤á°Ÿa(ìáҌÞC(ôá݇H(¬‚á	y°©a(´‚áBÞ(¼‚ámÞ(ü‚á	¨N?(ƒ†¬¯(#ƒë°Þ)Œ‡ác±Kb)ˆáҌÞC)ˆá݇H)¤Šá	ɱ[b)¬ŠáBÞ)´ŠámÞ) ‹á	¨N?)(‹†¬¯)G‹³Þ*c‹k™Þ*ú‹†¬Þ*Œ†”³*ÁyÁy08ÇyØy‹!08ÇyØy‹!ÁyÁyãyâxÒxðyõûyÁyðyðyzõãyzzÁyÁyÁyãyzz#zÁy=z=z=z=zÁyHz=z{zz{zz÷7ƒz”zÁyÁyÅ.ŸzÁyÁyÁyÁy¯z´z¸z¸z´z»zÂzÂzÉzÌzÁyÁyÁyÏzÓzÏzÓz¸z×z¸zÉzÏzÓz¸z×zÏzÓzÏzÓz¸z×zÏzÙzÏzÙzâzuâzuçzçzçzçzçzîzÏzÉzÏzÉzÏzÓzÏzÓzÏzÓzÏzÓzÏzÓzÏzÓz¸zòzòzøz{¸z™{{{¸zâz™{{{{{{{{{{{{{{{{{{{{{{{{{{{ÏzÓz{#{{#{ÏzÓzÏzÓz{){{){{){{){ÏzÓz¸z{¸z{{+{{-{5{:{<{D{){I{{-{5{:{Q{D{){I{	™¸zY{{{¸za{¸za{i{{} †{{} †{£ÁyÁyÁyÁyÁyÁyÁyÁyÁyÁyÁyi{Ž{} †{“{ÁyŽ{} †{ {¤{ {¤{÷7 {¤{ª{¯{·{¼{ÁyÁyÁyÁyÍ{×{zÁyÁyÁyÁy‹!zÍ{Í{×{08Øy‹!08Øy‹!å{ü{|å{ü{å{å{ü{|å{ü{å{|Áy;vÁyÁy|#|²~¶~%|,|;v;v3|%|Hz<|×{i{{÷†{ÁyÁyÁy÷7i{{÷†{@|I|a|{i|p|u|z|…|ÁyÁyÁyãyzzuÁyÁy<|Áy†{Ž|†{”|||Ž|Ž|Ž|†{†{·|·|·|·|*¿|ÁyÁyÁyÁyÁyÁyÁyÁy--ü{É|É|Ò|Ò|Áyâ|â|æ|÷7{ãyzzÁyÁyÁyãyzzuÁyãyzãyzrµrõ|}¬.ÁyÅ~}#}†{Áyi{{4}{} †{{{?}?}+fÁyÁy?}?}å{ƒz÷7C}R}¤{zÁyY}n}Y}Y}t}Y}t}{}ãyzzãyz‹!·|·|}‹}z‹}¦}‹}¦}«}‹}¦}«}°}z‹}z·|·|}‹}z‹}¦}‹}¦}«}‹}¦}«}°}z‹}z·|·|}‹}z‹}¦}‹}¦}«}‹}¦}«}°}z‹}z·|·|}‹}z‹}¦}‹}¦}«}‹}¦}«}°}z‹}z·|·|}‹}z‹}¦}‹}¦}«}‹}¦}«}°}z‹}zµ}·|·|}‹}z‹}¦}‹}¦}«}‹}¦}«}°}z‹}z·|·|}‹}z‹}¦}‹}¦}«}‹}¦}«}°}z‹}z·|·|}‹}z‹}¦}‹}¦}«}‹}¦}«}°}z‹}z·|·|}‹}z‹}¦}‹}¦}«}‹}¦}«}°}z‹}z·|·|}‹}z‹}¦}‹}¦}«}‹}¦}«}°}z‹}z†{†{i|ÁyÁyz{z{¿4ƒz÷7} ¼}R}zzÈ}zÈ}{Ð}Ô}¯{} ‹!<|‹!<|‹!<|‹!<|‹!<|‹!<|‹!<|‹!<|Ù}ü{Þ}ä}Áyë}p|õ}þ}õ}þ}õ}þ}õ}õ}~~~p|p|"~%|,|4~4~3|%|Hz÷7û708} ¨rùu6~vŸzz¨rŸz¨rŸz¸zâzâzC~âzâzC~¸zC~âzC~×{†{ÁyÁyÁyÁyÁyâxå{ÇyK~c~N;¢;âxå{ÇyK~Å.„~Çyc~N;¢;âxK~Çyc~N;¢;âxå{K~Çyc~N;¢;†{—~Í{×{¤~«~‹!å{²~¶~²~¶~÷7Å~·|zÒxâx·|÷÷zãyâxÒxÁyÁyÁyº~R}Å~Å~Å~Å~ª{BÇ~Ð~BÁyÁyÁy08÷7}†{i|#}†{i{{÷†{†{†{ß~†{ß~ CÁyÁyÁyi|ê~<|×{ÁyÁyÁyÅ.ó~Å.ø~uÅ.Å.Å.Å.)3-+f} ;@K[ÁyÁyÁyÁyÁyÁy;iq{ÁyÁyÁyÁyÁyÁyÁyÁyÁyÁyÁy„œz÷†{÷ {¤{ {¤{÷7 {¤{Å.Å.¢²Å.Å.¢²ÁyÁyÁyÁyÁyÁyÁyÁyÁy÷7i{{} †{@|Í«~Ûâxå{ßâxå{Å~¿|Áyðyõt}ìó€t}
€€ÁyÁyÁyÁyÅ.õ€)€õz9€÷7Å.Ÿzt}ìóB€t}ìóÅ.ŸzÅ.O€e€{€ŸzuÅ.Ÿzuå_t}ìóÅ.B¦Å.B¦Å.B¦Å.B¦Å.Áy˜€=z=z--¥€--¥€ÁyÁy---¹€ƀހ€--âx;ƒz÷7±¨ÁyÁyz{}z08ù€0808;v0808;vÁyÁyÁyÁyÁyÁyÁy@} ÿ€@¯{%1ÿ€ÁyÁyi{{} †{ÁyÁyÁyÁyÁyÁyÁyå{ü{|â|Aå{ü{|â|AFN]hrY}Y}n}Y}Y}t}Y}t}{}‹’”Å~›{Å~›’Å~›{§²r]‹”Å~›ÁyÁyÁyÁy¼¿¿¿āρ-فށî@ف--·{-·{å-·{å+fñ-·{å+fý‚ñ%|,|-·{å-·{å3|%|HzÁy·|=z‹!.‚·|=z‹!·|=z.‚·|=z·|‹!·|.‚·|=‚B‚=‚B‚J‚<|ÁyÍ{ÁyT‚z‹!<|ÁyÁyÁy×{Í{Í{×{‹!ãyØyºm‹![‚i‚ãyØyz‚‹!;vØyãy‹![‚i‚‹!;v08ãy‹!;v‘‚¥‚‹!Å.vn}ãy‹!z‹!·|·|}‹}z‹}¦}‹}¦}«}‹}¦}«}°}z‹}z·|·|}‹}z‹}¦}‹}¦}«}‹}¦}«}°}z‹}z·|·|}‹}z‹}¦}‹}¦}«}‹}¦}«}°}z‹}z·|·|}‹}z‹}¦}‹}¦}«}‹}¦}«}°}z‹}z·|·|}‹}z‹}¦}‹}¦}«}‹}¦}«}°}z‹}z¾‚¾‚¾‚J‚‹!Å.ς¾‚J‚¾‚¾‚ã‚{%|,|¸zö‚¸zö‚3|%|Hz¸zö‚¸zö‚¸zö‚ÁyÁyƒÁy
ƒƒƒƒ÷7Å~Å~Å~,ƒ8ƒ}#}†{Áyi{{÷†{AƒzzzÁyìzzìz첁Áyz} }<|×{ÁyÁyKƒz;vü{|ãyå{ãyü{|Sƒå{ãyü{|qƒSƒå{ãyü{|‚ƒãy‚ƒãyãyzŒƒÁyÁyÁyÁyÁyÍ{J‚<|Áy±³©ƒ{ÁyÁy¶ƒt}t}·|·|}‹}z‹}¦}‹}¦}«}‹}¦}«}°}·|·|}‹}z‹}¦}‹}¦}«}‹}¦}«}°}·|·|}‹}z‹}¦}‹}¦}«}‹}¦}«}°}·|·|}‹}z‹}¦}‹}¦}«}‹}¦}«}°}·|·|}‹}z‹}¦}‹}¦}«}‹}¦}«}°}ÁyÁyÁyÁyÁyÁyÁyƒÁyz·|·|}‹}z‹}¦}‹}¦}«}‹}¦}«}°}z‹}z·|·|}‹}z‹}¦}‹}¦}«}‹}¦}«}°}z‹}z·|·|}‹}z‹}¦}‹}¦}«}‹}¦}«}°}z‹}z·|·|}‹}z‹}¦}‹}¦}«}‹}¦}«}°}z‹}z·|·|}‹}z‹}¦}‹}¦}«}‹}¦}«}°}z‹}zÁyÁyˆˆˆ{ˆˆÅ~’œ—ˆˆˆˆˆˆˆˆˆˆ¨¨È«ˆˆˆ±³@@DH@PX@l@*D*@,1
1À4Ì7ØDEEOlO@QhXlX@Zd[D[@^uDu@|쀁ā
À‰dŒhŒÌ8<‘•XŸlŸ@¤5¦h«(¬d¯T¯X±Ìµvµ­µzµ•µ5¶¢¶­¶¦¶•¶5¹²¹­¹¶¹•¹5»v»­»z»•»5¼v¼­¼z¼•¼5ÀBÀ­ÀFÀ•À5Âv­Âz•Â5ÃjíÃnÕÃ5ÄvÄ­ÄzĕÄ5ÅvÅ­ÅzŕÅ5ÆvÆ­ÆzƕÆ5Ç~ǭǂǕÇ5ÈJÈ­ÈNȕÈ5ÉJÉ­ÉNɕÉ5ÊJÊ­ÊNʕÊ5Ñ2Ñ­Ñ6ѕÑ5ÒºÒ­Ò¾ҕÒ5ÓÞÓ­ÓâӕÓ5¬Þ	¬Þ¬W¬W!¬W)¬W1¬W9¬WA¬WI¬WQ¬WY¬Wa¬Ti¬Tq¬Wy¬W¬r<‘¬r<™¬y<©¬¯±¬Þ¹¬WÁ¬Þ4ÄaK1	¬ÞɬW9üÜ<<…2ÞÑl†~Ù„†÷<á¬WÙ¿†ý<éφ=é؆ÞD¬Þé݆Óéæ†Þ)¬)¶W)í†W)5
ñ¬(=L&CT3‡L=\<‡]=\&C	¬W¬Þ¬j=qo‡Wd‰‡x=l„†‰=—‡DTφ£œ‡Ž=ѧ‡´º‡”=qÁ‡WqÁ‡ž=qLJÞ)݇HihÞæ‡\1¬j=t¬Þû‡ˆÁ=9ˆÉ=t$ˆÏ=y(ˆD11ˆû1‰Kˆ×=‰PˆQ¬TTfˆ%>+>‰>a¬Þ	D™ˆt	‹	¬Þφ=݆Óq¬WۈN?áˆY?‰¬W9ˆ^?‰¬ޑ¬W™¬Wá¬Þ¡¬W©s.9©tî±P‰‡?	¬ö	Z‰Ä?¹¬ÞÁ
Šç?+	@¹¬WɬWɬö	„ŠH„*Š‰=Ñ4Š´¹ÁAÁIŠ
¹ÔÎA„¬ÖAZ‰ÜAÑQŠãAÑ`ŠDъuD}ŠíA…ŠòAŒŠHŒŠ‰=T¡ŠBü+>Œ¬ÖAѬÞÑ»Š?BÑû‡ÑáˆY?ÑŠ¯Á¬WÙ¬Þá¬ÞÙhZBI+ÞIºc¯IùŠû1‰Á‡`B‰
‹Þ‰‹ÞI‹Þ9Ü<‹‰>”‰‡x=œ„†‰=¤%‹‰=¤*ŠÖBT$ˆÏ=¬$ˆÖAá7‹CéX‹(Céj‹_é
Dá7‹0C¼ÄaK1ñ¬¬Cɬ…2Þĉ‡x=̄†‰=)¿‹DZ‰˜)ȋWы;&Ct¬¯‰‡ÞC)„†N?Ï†6ÙÿùC	ü‹DŒ‰>Œ1DÔŠHÔ*Š‰=AŒ1 Dܬ¬¬¯äŠH䏊‰=	 D\Ó-%>ä*Š‰=	fŒÌDÐDÎýD	wŒEä¬ÖA\+ÞˆE\$ˆÖA¬¬ÞÓ-
쉇x=Y‰‡ÞCô„†‰=)gÞ¬Þ!šŽŸE!¬Žü“–üˆ–ü¬¯üӍ|Eüp||EüšŒx=&C¬¯üݍ„EüøEüíÊÓ-%>$ˆÖAüÿŒÊüŽÞümÞ)¬Þ¬¯Ӎ|EãŽáE¬çEiñŽ}ŠîE9ýE	¬F9'Ft¡ŠBtfˆ%>t3‡_Ft&Cá$ˆkF9=D¬2QYýÑd¡FqLJÙq
‹Þɬö	$¬Þ$$ˆÏ=Y†åF)¬Þ)¤êFa»Ti¬Þq¬Þy¬õG\ËH‘φÑH¡*ŠDÁIŠ+>‰¬ÁuØH9¬W9M-D©¬W9D-D9X-9a-D9r-D)D-D)WéH…ŠòHÔ¬ÖA9¦;,¬4$ˆÖA4‰‡êI<„†‰=<݇HD‰‡x=L„†‰=AÐDTφ6J9ېRJAÔ™J4¬Þ¹s.¶J<“ÒJÑW“\¬Þx“ðJÙ‰‡ÞC\$ˆÖA\“Þd‰‡x=l„†‰=Ù&CÑ*ŠD²”‡K²”‡?t݆Ï=áÀ”±Kñ攼KAå2ÀAå2ÅAë2èAë2ÓAë2ÙAë2àA3ÀA3ÅA3èA3ÓA3ÙA3àA3ÀA3ÅA3èA3ÓA3ÙA3àA'3ÀA'3ÅA-3èA-3ÓA-3ÙA-3àA93ÀA93ÅA?3èA?3ÓA?3ÙA?3àAK3HA^3HAp3HA‚3HA•3H1¬2yð”Da"]DѬ¯Q•ýÑ»Š<L)¬D)X-)M-DÁubLá:•nLá
DO•òA;xòA¬¯$ˆö		V•
	^•D	i• L9¬DQy•¥L	Š•D	š• L9¬¹LáφÆLInEWI£•ö	í•6ѬWt‰‡
Mt„†MÑu*Mt݇HÑø•2M|‰‡êI„„†‰=Œ‰‡x=”„†‰=œE#£„݇H¤“–¤ˆ–¤¬¯¤
– M¤õ} M¤–¨M¤þ}¨M¤šŒx=¤5–E¤*–ʬE#£¤ÿŒÊ¤@–Þ¤mÞ´¬¯´
– M´–¨M¼E#£Ä“–Ĉ–Ĭ¯Ä
–õMÄõ}õMÄšŒx=Äh–9KÄ]–úMÄÿŒÊÄ~–ÞÄmÞÄs–>K̬¯Ì
–õMÔ~?Nä&Cì‰‡x=ô„†‰=ü%‹‰=ü*ŠÖBÑd«N¬Þ~?N¢–NN¬¬¼$"~"Ñؖ?Bu)OŒ
Ñؖ/O,¬Þ,"~",ȖO4¬<¬¼D÷7ÊDû7ÎLE#£T݆Ï=¬æ‡”O㖚O9薻¬Þ¹—¨O¹­OZ‰µO<S2y<d2Š<s2“	—E	$—E90—D>—XP9F—ýqLJWqLJÀT¬i¬W\%‹‰=d¬\*ŠÖB9 —D¬³—QlŠHl*Š‰=t¬Qt&Ctφ6J|¬Þ|$ˆÖA|“Þ?/)O,E#£„‰‡x=Œ„†‰=”‰‡x=œ„†‰=}Š:R¹ÎBR¹Õ™S	KR¹WR	Ì D¹aRå™ D¬kR¬Þt¬ŒR)¬W‰Ꙑ‰÷™5<‡¾R¬Þ!¬Þ)¬Þ1¬ށ;x6‘›D9¬W¹s.îR¹/›H¹@›÷R¹M›D¹ŠuD¤‰‡x=¬„†‰=Ig›DIu›D´“–´ˆ–´¬¯´’›;´;;´šŒx=Áu)OÁ+CS´œ›,S¡+œD´¨›;™7œH¡Cœ¡û‡Á+OS´¶›,S´Û;´Λ;´ڛS´æ›,S´ó›–´œ–´œ,S´œÊ‘φXSQMœý¡#/_SQ$ˆö	lœeS´ÿŒÊ¼¬¯¼’›;ÑdƒSÁ¬‹SY¬ö	a¬Þ	œ¦éҜâS©¬èS©ߜöSĬ¯Ä$ˆÏ=Ä¡ŠBA¬Þ¬&C¹
_TÎlT̬ÖAÌŠHÌ*Š‰=T?x%>„Š‰=¹†TLÓ-%>¹ÔòTL+Þ"ö	y¬ty=A	y¬ UÔ‰‡x=Ü„†‰=ä¬Þä³—Qä&Cì‰‡x=ô„†‰=ü‰‡x=„†‰=I¬ޑ¼¥	V‘tª		¬FV	ç D¹Û†TË¥aV¹Ï¥Ï¹¬†V	Ù¥F1‰¬î‰ê¥!2‘¬V‰¦\‰+Þ¹'¦Ï¹¬¬VE#£©¬î±¬î¹¬î¬–aDéÙ¥W°aF1©¬Þ9¨;¬8¨:W9X¨;)¬Wf¨D9w¨H$¬Q$‰‡êI,„†‰=Qφ6Á’¨ýÁIŠmWÉ™¨D,݇H4¬ä$ˆÖA9´¨D)Á¨W)̨¯‰Õ¨3X‘ߨމû‡Ï¬`B‰÷™OX‰ï¨†Vä¬QäÓ-%>Á«cÒÑ^ED‘¬WÁÉcDÑ,×Ñ©
‘©ÏX‰$©ÏÙ:©ûXÙ?xûXÉE#Ë4¬Þá¬PYñ¬W¹¬÷ù¬Z	¬õGÏ©åFQ¬ÞɬެÞ!þ©<<ég 5Dfˆ%>D$ˆÏ=Dφ£!ª<<ûg,5DQ4†ZL‰‡ZT„†ÖBT݇HD¬Þ\Ó-%>\$ˆÖA\&C\¬¯\‰‡êId„†‰=d݇H\?x%>\¬Þ$¬Þ	¬Þ9¬Þ9¬WQhT	‡hÞAL«E[I¬K[¬¬Ql¬Qِ«\t‰‡x=|„†‰=9Ï«D„¬ÙÔ‹[Ù¬”[„E#£Ñ¬Ï$¬¯[Ñ(¬û1‰/›µ[ù¬Was.Ð[AE¬T	[¬ÌDA"+¯aC+¯Aq¬Ta¬Ø[A¬WanEWaš¬†Va¬¬WAĬß[iÕ¬Taë¬û1ag.å[ùhå[q¬\a¬Û6a¬â6á­\a¬ÞaTkâ6á&­2]¬Þd2Šs2“‰¬0^™¬0^‰­7^©¬@^¹¬0^Á¬G^Ѭ0^Ñ>®N^‰K®Þéj®_^Z‰d^éj®<é{®_^é{®<鈮_^鈮<ñ“®Hñ¤®Hñ²®HñîHñ¬ö	Œ¬ތfˆ%>Œ݆Ï=Œφ£Œ‰‡
M”„†Mœ%‹‰=œ*ŠÖBZ‰è^”݇HŒ¡ŠBŒ$ˆÏ=a¬Wiü_iù®i¬¾_|¬Þ|$ˆÖA|φ6J¤$ˆÖA¤‰‡êI¬„†‰=¬݇H¬‰‡êI´„†‰=¬Ó-%>´݇H¤¬ÞñÐDù¯<q¬Þq‰‡ÞC¼‰‡x=Ä„†‰=䬯䉇êIÌ„†‰=Ì݇Hiç_Ô¬ÞÔ$ˆÖAÔ“¸bÔ&CÔ‰‡êIÜ„†‰=Ü݇Häφ6Jäφ6Jd2‚S2yì¬Þì݆Ï=ì¡ŠBì?x%>ìQ4†Zô‰‡Zü„†ÖBü݇Hì&C¬¯$ˆÖA‰‡êI„†‰=݇Hl¬ÖA¼¬Þ>04¢8§<Â` d¥hªtÀxÕ|€7	„|ˆ ¢¤¨¢–LP¢T§Xó\	|€¢„§ˆã	Œè	œ
 A
°n´¸ž¼ÃÀêÄÈ$ÌKФu‚04¢XeœI  ¤©¨Æ¬Ï´Y¸r¼¡ÀÖÄñÈÌÐ7Ôèì¢	ðŒô‘XètGxL|Ž<j @­ Dô H7!Lz!PÉ!T"XQ"\š"`á"d,#hw#l¸#pû#t6$x…$|Ö$€#%„f%ˆ¹%Œ&[&”¨&˜ó&œP' Á'¤(¨Y(¬ª(°)´f)¸ß)¼2*À‡*Äà*È?+Ì„+ÐÉ+Ô,ØW,Ü¢,àë,ä:-èƒ-ìÔ-ð!.ôn.øÁ.ü
/[/¬/û/L00î0=104¢8§Hæ1h*2lW2x„2|Ï2€3„93ˆB3ŒW3h3”y3˜Š3œ•3 ¦3¤­3¨º3¬Ë3°Ú3´ë3¸ü3¼ÿ3Ì4Ð$4Ø‚4Ü•4àÀ4äé4ìð¢¢§ã	è	C5hk6Œ¢”§˜ã	̝Тԧܝà¢ä§9j9 ð9$i:H2;\`¢Ä4È$4 »¢.{e.#Ðd.+âd.sâd.ƒ5e.›³C.£Le.«Ue.3âd.;âd.CÐd.Kèd.Sâd.ce.kßK@»¢C³€<`»¢€»¢ó>Ợã³9>»¢	S/=!»¢A»¢`»¢€»¢ »¢À»¢a»¢»¢¡»¢©³›>Á»¢É³¼>Ợã³nBé³ò>³CC	³ ? »¢@»¢»¢ »¢@»¢`»¢€»¢ »¢É¢ã³>³#I#³•I`»¢€»¢A»¢a»¢»¢¡»¢Á»¢á»¢»¢!»¢#CåK#sßKA»¢a»¢»¢¡»¢»¢	S/=!»¢A»¢IÛ³Ca»¢iÛ³C‰Û³C£³êO©Û³C	»¢¡	»¢Á	»¢á	»¢
Ȣ!
»¢ã
£¢ã
›¡Sã
»¢»¢!»¢)£¢)³ðFA»¢C³>I³#GI£¢a»¢i«uGi³IG»¢‰³‰G‰«¶G¡»¢©³ûG©³ÊGɳûGɳ4Hã³Vé³_Hé³ûG	³H	³ûGé
S/=c³÷Wƒ³}XỢ»¢!»¢A»¢a»¢cÃ/=c{&YƒãZƒËYƒÓ³Yƒ{WYƒÛ/=ƒsßK¡»¢»¢!»¢@+¢IS/=»¢!»¢A»¢ƒ³]]Á»¢!»¢A»¢¡»¢!»¢#³`A»¢C³aa»¢»¢¡»¢Á»¢Ã³Pa)³ò>I³ ?c³Ðai³cQ£³acã³d C‰A`»¢c»¢€»¢ »¢£»¢À»¢Á»¢Ã»¢á»¢»¢»¢ »¢#»¢C»¢c»¢ƒ»¢£»¢À»¢Ã»¢à»¢ã»¢»¢»¢ »¢!»¢@»¢A»¢C»¢`»¢a»¢c»¢€»¢ƒ»¢ »¢£»¢ÁS/=û¢á»¢ã»¢»¢»¢»¢ »¢#»¢A»¢C»¢a»¢c»¢»¢ƒ»¢©Û³CÉÛ³C»¢»¢!»¢#»¢A»¢C»¢a»¢c»¢ƒ»¢á»¢»¢!»¢@»¢A»¢`»¢a»¢€»¢»¢ »¢À»¢à»¢»¢ »¢»¢!»¢@»¢A»¢`»¢a»¢€»¢»¢ »¢¡»¢Á»¢à»¢á»¢»¢»¢ »¢!»¢@»¢A»¢a»¢»¢¡»¢Á»¢!»¢A»¢a»¢»¢Á»¢á»¢ »¢! »¢` Û³C »¢¡ »¢Á »¢á »¢!»¢!!»¢A!»¢a!»¢`"»¢€"»¢À"»¢à"»¢@#»¢@%»¢`%»¢€%»¢ %»¢À%»¢à%»¢ '»¢À'»¢à'»¢é'³#W(»¢ (»¢@(»¢ (»¢À(»¢à(»¢)»¢)»¢!)»¢@)»¢A)»¢`)»¢*»¢!*»¢a*»¢i*³
Y*»¢‰*³Y¡*»¢Á*»¢á*»¢+»¢!+»¢+»¢¡+»¢	.C:]A.»¢¡.»¢@/»¢`/»¢@1»¢ 1»¢À1»¢Á1S/=á1S/=2»¢ 2»¢@2»¢`2»¢À2»¢à2»¢3»¢!3»¢€3»¢ 3»¢à3»¢!4»¢i4³na 4»¢À4»¢!5»¢A5»¢a5»¢ 6»¢@6»¢`6»¢€6»¢¤6¢$8¢Ä8¢@9»¢`9»¢¡9»¢Á9»¢á9»¢é9³
Y	:³YD:¢ä:¢d<¢=¢„>¢$?¢¡@»¢¤@¢dA¢A»¢B»¢!B»¢äB¢C»¢„C¢¡C»¢ÁC»¢áC»¢D»¢!D»¢AD»¢aD»¢DS}cE¢AE»¢aE»¢E»¢¡E»¢¤E¢ÁE»¢àE»¢F»¢ F»¢@F»¢$G¢ÄG¢I»¢DI¢äI¢dK¢ÄK¢Q»¢ Q»¢€Q»¢ Q»¢ÀQ»¢àQ»¢R»¢ R»¢`R»¢€R»¢`U»¢€X»¢ X»¢ÀX»¢@Y»¢`Y»¢€Y»¢ Y»¢ÀY»¢àY»¢]»¢ ]»¢@]»¢`]»¢€^»¢ ^»¢À^»¢à^»¢_»¢ _»¢``»¢€`»¢ `»¢À`»¢ a»¢¤a¢Àa»¢àa»¢b»¢ b»¢@b»¢`b»¢€b»¢ b»¢Àb»¢àb»¢c»¢¤c¢dh¢àl»¢m»¢ m»¢@m»¢`m»¢€m»¢ m»¢Àm»¢àm»¢n»¢ n»¢@n»¢`n»¢€n»¢ n»¢Àn»¢àn»¢o»¢ o»¢@o»¢r»¢ r»¢@r»¢`r»¢€r»¢ r»¢àr»¢s»¢`s»¢€s»¢às»¢t»¢ t»¢Àt»¢ w»¢àw»¢x»¢y»¢ y»¢@y»¢`y»¢€y»¢ y»¢Ày»¢ày»¢À|»¢à|»¢}»¢ }»¢@}»¢`}»¢€}»¢ }»¢`»¢€»¢ »¢À»¢€»¢À»¢à»¢‚»¢ ‚»¢`ƒ»¢€ƒ»¢ ƒ»¢Àƒ»¢àƒ»¢„»¢ „»¢@„»¢`„»¢€„»¢ „»¢À„»¢à„»¢…»¢ …»¢À…»¢à…»¢†»¢€‡»¢ ‡»¢ ˆ»¢Àˆ»¢`Ž»¢€Ž»¢ Ž»¢ÀŽ»¢ ‘»¢À‘»¢Ē¢d”¢À•»¢à•»¢ä•¢@–#¢`–»¢€–»¢„–¢ –»¢À–»¢˜¢¤˜¢$š¢Ě¢Dœ¢äœ¢dž¢@¤»¢`¤»¢€¤»¢§»¢ §»¢©»¢ ©»¢઻¢«»¢ ¬»¢À¬»¢Ä­¢„¯¢ ¯»¢À¯»¢௻¢°»¢ °»¢@°»¢`°»¢€°»¢ °»¢À°»¢D±¢²»¢`²»¢€²»¢ ²»¢À²»¢³¢Ä´¢Ä·¢€¸»¢ ¸»¢À¸»¢฻¢ ¹»¢@¹»¢D¹¢`¹»¢€¹»¢ä¹¢@º»¢`º»¢d»¢¼¢„½¢$¾¢¤¿¢DÀ¢€Á+¢ Á+¢ÄÁ¢àÁ+¢Â+¢@Â+¢`Â+¢ Â+¢ÀÂ+¢Ã+¢ Ã+¢`Ã+¢€Ã+¢ÀÃ+¢àÃ+¢ Ä+¢@Ä+¢€Ä+¢ Ä+¢ Å+¢@Å+¢€Å+¢ Å+¢àÅ+¢Æ+¢@Æ+¢`Æ+¢ Æ+¢ÀÆ+¢Ç+¢ Ç+¢ È+¢@È+¢€È+¢ È+¢àÈ+¢É+¢`É+¢€É+¢ÀÉ+¢àÉ+¢ Ê+¢@Ê+¢`Ê+¢€Ê+¢ÀÊ+¢àÊ+¢ Ë+¢@Ë+¢€Ë+¢ Ë+¢àË+¢Ì+¢@Ì+¢`Ì+¢ÀÌ+¢àÌ+¢ Í+¢@Í+¢€Í+¢ Í+¢Î+¢ Î+¢`Î+¢€Î+¢ÀÎ+¢àÎ+¢@Ï+¢`Ï+¢ Ï+¢ÀÏ+¢Ð+¢ Ð+¢€Ð+¢ Ð+¢àÐ+¢Ñ+¢@Ñ+¢`Ñ+¢ÀÑ+¢àÑ+¢ Ò+¢@Ò+¢€Ò+¢ Ò+¢Ó+¢ Ó+¢`Ó+¢€Ó+¢ÀÓ+¢àÓ+¢Õ+¢ Õ+¢`Õ+¢€Õ+¢ÀÕ+¢àÕ+¢ Ö+¢@Ö+¢€Ö+¢ Ö+¢àÖ+¢×+¢@×+¢`×+¢ ×+¢À×+¢Ø+¢ Ø+¢tea\<´·
¸Á`Í€ÎÀÏò<==e=£=ß=þ=1>‘>•>U?c?l?s?x?}?‚?”?ž?§?­?³?¸?Ê?Ñ?Ö?Ü?ñ?@@@-@B@V@k@~@Œ@@¬@·@Ç@Ì@Ó@ß@AAA"A0A?AXAdAkAÉAéAÿA B:BFBUBhBœBªBâBþBC6C=CÍCäCÿCD%DDªD×DE0E@E^E­EÇE×EøEF-F7FIFsF‚F™FªFËFÚFáHøHII}IýIJ<J]J“J JªJ¾JÇJÜJúJHKNK_KeK’K¸KÃKCL\LtL{LˆL«L±LÀLÍL×LßLæLíLM:MzM”MºMÕMèMNN!N*NµNO5OoOyO¡O»OÚOàOy^PjPuP~P­P¾PóP!Q1QJQ]Q Q³Q»Q#RqRwR}R˜R¦R²RÆRÑRÚRýRS9SkSyS“SðSTT#T-T3TPTeT{TŽT»TUHU]U„UUšUÍUèUîUôUúUVNV\VgVmV~V›VºVÈVÔVáVW-WIWOWvWÖWñW8XVXpXÕXÝXõXY@ZGZaZnZ{Z´ZËZÜZìZ[&[-[6[<[Z[o[š[½[Å[ë[›]§]®]¿]Æ]â]é]ü]
^!^*^U^y^¸^ð^._M_p_x__§_¸_Ä_ç_``F`t`æ`î`û`1a=aDaia™a³a¹aÅa&bŽbbÑbc(c3cc–c¢c½cçcdˆdŸd¬d¹dÃdxCfå	
*-24=HLQT!W%X&a'j(n)p*r+w,z.€02‚3ƒ4ˆ5Ž9:”<•@–C™D›EK©L¬NµO¼P¿QÂUÆWÍXY Z#[+\1]3_4a>p?qAsCtEuLxPyRzUVƒW„Y†b‰cŠiŒqy‘•‚—‹›ŒœŸ‘¡•¢—£š¤›¥œ¦Ÿ§£¨¤©¦«¨¬³­¶®·¯¼±É²ÎµÑ¶Ó¹Õ»×¼ÙÀÛÂÝÃßÄáÅãÆåÇçÈéÉëÊíÑïÒñÓój_Ï
eèkkpu(z€1…FPèý0
5;Ï
eSLpPoP¼¢¼¨P³s¼¢¼~™íLõ9LBLîµHLëºQL"	Ã^LiLqLzÍ‚L‹L¶FÜKáSæFÜKáSæ'"8uœPÿ@;
†!L#!‹6!‹I!sœPÿ‘]!@kpõ"PÿáÚ
æ#ì!#ö6#1(Fö#M$L%$Ru
X&Ý/&çA&ç‹L¶“'m	˜'s	£'x	{(Ì	Ò	~(Ø	)F’Y,˜j,˜r,¼…,¼™,ž¨,ž·,žË,žü-P.L.L.¼.L).L6.uD.u`.P
5Ï
e;ý0{(Ì	ÿô.uÏ
eã/kî/P0u‹L¶1L1L1u–1Mš1S£1[¯1e¼1oÌ1MA2LÔ2æÿ»¨3P·3PÅ3PÓ3Pâ3P44¨3P·3PÅ3PÓ3Pâ3PíL˜4çö#L$Lõ4P5L
Lã7Ÿ»8@¢
FÆ8¼9k
u]9Sm9S¶<uÇ<PÐ<u=Mö#MÌ1M$L=oÏ
e8=kl=S¬=S¼¢¼x?P @}©@¼Á@PÛ@Lç@Pý@}A}>A}aA[FL¹BnÆBLÕB˜åB˜éBPóBnã/k‹L¶íL^CP³7¼ö#M$L%$Ru
XyFu„Fu’FuRE< FL­FP´FPiG¿zÅ|PŸ’PŸ©PŸÃPŸçPŸýPŸ3QŸSQŸ~QŸ¡QŸ¼QŸ×QŸêQŸ
RŸRŸDRŸiRŸ•RŸ§RŸÀRŸãRŸSŸCSŸjSŸSŸ¡SŸÅSŸéSŸöSŸTŸ<TŸfTŸtTŸ…TŸTŸ¤TŸ¯TŸ×TŸèTŸUŸ"UŸDUŸ^UŸ|UŸ˜UŸ¶UŸ×UŸüUŸVŸ&VŸNVŸkVŸˆVŸ£VŸÓVŸôVŸ	WŸWŸ;WŸQWŸuWŸŠWŸœWŸ­WŸÀWŸÙWŸûWŸXŸ XŸ9BHë"	^iq‚öXu‹L¶•
3Y;AYu}Z;„ZLÏ
e‹ZP˜ZL•
3Y;AYuº[çÉ[ºîjß[;‹L¶ü\¨]PS]"ÿ^ø _P7_L>_nE_˜U_æ__néBPg_˜z_þ`¼ÚaLãaR1
uÂbP¨à15¥d%2´dÜRE<¿dLKáyFuÏdujePteL‹L¶¨P³sFÞ]4…!c4x?PÔ2æÙhLîhLF’r,16…,16Y,øj,ø™,56·,>6¨,56Ë,>6ÂjMÓMËkP×kPçk3Y;AYu!7§l@»lu_7ö#MÇlP
7Úlk%$Ru
Xö#M$L
56!‹6nuÂjMŒn¨3P·3PÅ3PÓ3Pâ3Pš1S
uso8I!sppP_7zpPÇlP’pP¨pMö#M¸pd8¿
sÀsoÄsoÕsLÀsoÕsLã/÷80u‹L¶œP!L
†Ï
eKsLKsLKsLÿ"!LœPö#M$L%$Ru
XÞLÞuìuO;œP!LÅ.e#!‹¸w;!7_7»luö#MÇlPÚlkÅw7§l@•
3Y;AYuÕsÒ	¨3·3Å3Ó3â3¸pd8ppP_7zpPÇlP’pP¨pMö#M6nu!LœPœyu¦yu¨3P·3PÅ3PÓ3Pâ3PFÞb<…!g<Ž–ECŽ›E[’JCŽ›Ec”BKCŽ›EŽ–ECŽ›EŽ–ECŽ›E‡™RCŽ›EŽ–ECŽ›E-žMCŽ›E 5CŽ›E 5CŽ›E 5CŽ›E£ÇUCŽ›E‰¤8CŽ›E‰¤8CŽ›E‰¤8CŽ›EɯLCŽ›Eù°®aCŽ›E ³ˆbCŽ›E:9	


 !#"%$&(!)#+%,%<';'=)>)C+B+D-E-F/G/I1H1a3¬5­7³9´9µ;¶;·=¸?¹?ºA»A½C¼C¿E¾EÀGÁGÃIÂIÅKÄKÇMÆMÉOÈOÊQËSÕUÖW×YÚ[Û[Ý]Ü]ß_Þ_áaàaãcäeågêiëiíkìkîmðoïoòqñqõsöuùwúy{}
ƒ……‡‰‰‹#‘$“%•&—*™+™-›,›/.4Ÿ5¡>£=£@¥?¥B§A§F©E©G«H«K­J­R¯a±c³d³fµeµh·g·i¹j¹l»k»n½m½p¿o¿qÁrÁzÃ{Ã|Å}Ç~Éˀ́ςуӍՎՏבِْۓۖݗݚߝáœážã å¤ç¥é¦é§ë¨í²ï±ï´ñ³ñ·óÂõÃ÷ÄùÅûÆýÇÿËÊÒ×ûü	ýþ
ÿ'()*+0/21>!?#@%A'C)I+t-u/v1ƒ3„5†7‡9ˆ;‰;Š=‹?ŒAACŽCE‘E’G“I”IšK M©OªQ´S³S¶UµU¸W·WºY»[¼]½_¾aÀcÁeÂgÃiËkÊkÍmÌmÎoÏoÐqÑsÒuÓwÚyß{à}èéëêíƒìƒõ…ô…ö‡÷‡ø‰ù‰ú‹
‘‘““••——™›! "Ÿ#¡$£%¥&§'©(«)­*¯+±,³-µ.·/¹0»1½2¿3Á4Ã5Å6Ç7É8Ë9Í:Ï;Ñ<Ó=Õ>×?Ù@ÛAÝBßCáDãEåFçGéHëIíJïKñLóMõN÷OùPûQýRÿSTUVW	XY
Z[\]^_`abc!d#e%f'g)h)j+i+k-l-m/n/p1o1q3r3t5s5u7v7x9w9y;z;}=~?‰AŠC‹EG‘G’I“I•K”K–M—O˜O™QšSœU›UŸW W¡Y¢Y£[¤[¦]¥]«_¬a²c¼eÀg¿gÆiÇkÈmÉmËoÊoÍqÌqÎsÏsÑuÒwÓyÔ{î}ñòóüƒûƒþ…ý…‡‡‰‰‹‹ !‘"‘$“#“%•&•'—(—.™-™/›0›12Ÿ8¡7¡<£=£>¥@§A§B©C©E«F«\­g¯h±n³oµpµq·r·s¹t¹v»u»y½z¿{Á|ÌōǎǙɚ˛͜ϝѢӣӤեצ٧ۨݩߪá®ã¯ã°å±ç²é³ë´ë¶íµí·ïÇñÉóíõî÷ïùðûñýÿÿ
	
+,-/0!4#8%9%:';)B+C-H/I/J1K3O5R7W9X9Z;[=b?cAdCfEeEhGgGmInKpMqOuQ}S~SU€U‚WWƒY„Y†[…[‡]ˆ_‰aŠc‹e’g“i”i•k–k›m¼o½q¾s¿uÀwÂyÃyÅ{Ä{Æ}Ç}ÈɁʁ̃˃ͅ΅χЇ҉ӉԋՍ֏ّ“•—™›Ÿ	Ÿ
¡¡£¥§©!«$­,¯/±5³8µD·G¹N»Q½V¿YÁ_ÃbÅiÇlÉsËvÍ}πчӊՑהٛ۞ݫ߮á´ã·å½çÀé”X–Z˜\š^ž`ôÊhXfPdNjZ*R\*PZ*NX*V^EE@ERETOÀZO¾XOÂNOÄPXúXXüZXþPXN[XZ[T^[VX[R\uh^udZuf\ubX‰6	Ÿt
XŸv
ZŸx
NŸz
P«R	µƒµ…µ{µ‡µ ‰µ"}µ$O¶0!¶,…¶.{¶*¶2‰¶4}¶6O¹<=¹>…¹@{¹B?¹D‰¹F}¹HO»Rƒ»T…»V{»X‡»Z‰»\}»^O¼j‡¼f…¼h{¼dƒ¼l‰¼n}¼pOÀ‚À„…À†{ÀˆŸÀŠ‰ÀŒ}ÀŽO–ƒ˜…š{œ‡ž‰ }¢Oì]è…ê{æ[î‰ð}òOĸeĺ…ļ{ľgÄÀ‰ÄÂ}ÄÄOÅÌeÅÎ…ÅÐ{ÅÒgÅÔ‰ÅÖ}ÅØOÆægÆâ…Æä{ÆàeÆè‰Æê}ÆìOÇôiÇö…Çø{ÇúkÇü‰Çþ}Ç
OÈ
¡È

…È
{È
£È
‰È
}È
OÉ"
£É
…É 
{É
¡É$
‰É&
}É(
OÊ0
¡Ê2
…Ê4
{Ê6
£Ê8
‰Ê:
}Ê<
OÑP
gÑR
…ÑT
{ÑV
iÑX
‰ÑZ
}Ñ\
OÒh
EÒd
…Òf
{Òb
CÒj
‰Òl
}Òn
OÓt
ùÓv
…Óx
{Óz
ûÓ|
‰Ó~
}Ӏ
O#+3Î<ä<=8=E=V=r=‚=¹=R?ºA÷AµBÁBÎBÛBC£C¼CÄCD‡D˜DmEtE¥E·E¿EÌEÏEÑF×IáIôIJ'J0JçJ
KKMNMWM`MgMoM²MÄMÍMßMýMN_NiNrNNNžN¨NÚNäNøN!ONOVOcOƒO‹O›PÐPÙP+QAQ—QÝQåQ)R1R	SS1SqSTsT'U/UNUhUpU U¨UïVW3W[WdWÌWNZVZ’Z©ZÓZãZR[`[g[ƒ[k^Ì^Ú^ï_ø_?`:bBb”b¯bÂbc†c©c³cÕcÞc083ب4 «5Ðè6 :8€:9;:P<;°<<0==>>ð>?p?@€¢ ]•
±žš&
òñ3
.6ѳ@´ *´ [´ø‡´ð²´ÀÞ´
=<><HGIGJGSRa`cbdbebfbgbhbihjhkhlhmhnbonwv…„˜—™—š™›™œ™™ž™´³µ¶*·³¸³¹,º<»<¼<½<¾<¿EÀLÁ³ÂVÃ\Ä\Å\Æ\Ç\È\É\Ê\ËqÌqͳγϳЄѨҨӫԫ^
z
z
|
à

j
v
x
zß7zá7|
„
Ï
û
C
u
µ
¹
»
½
¿
Á
Å
Çß7Çá7É
Ë

=
å
5
w	
Á

Æí<+CÀØCtZE½ZE¸ZE¼CÊC¸§PºèP4S+JSÊWU´‹V¥ZE4UW¼WUÈWUÄWUÊËb
ÑllD@@D Ñ!D"D<Module>DotNetOpenId.dllOpenIdProviderDotNetOpenId.ProviderKeyValueFormConformanceLevelDotNetOpenIdIProtocolMessageEncodingKeyValueFormEncodingDirectResponseDotNetOpenId.RelyingPartyCheckAuthResponseIdentifierSecuritySettingsRelyingPartySecuritySettingsElementDotNetOpenId.ConfigurationBigIntegerMono.MathSignModulusRingMontgomeryKernelIExtensionDotNetOpenId.ExtensionsIExtensionResponseIClientScriptExtensionResponseClaimsResponseDotNetOpenId.Extensions.SimpleRegistrationIResponseResponseIRequestRequestOpenIdRelyingPartyEndpointSelectorIAuthenticationResponseIExtensionRequestPolicyRequestDotNetOpenId.Extensions.ProviderAuthenticationPolicyAssociationPreferenceXrdsNodeDotNetOpenId.YadisAssociateResponseNistAssuranceLevelAliasManagerMessageEncoderSigningMessageEncoderExtensionManagerUntrustedWebRequestSectionRealmDirectRequestAssociateRequestRelyingPartyReceivingEndpointFetchResponseDotNetOpenId.Extensions.AttributeExchangeXriIdentifierServiceElementDHKeyGenerationOrg.Mentalis.Security.CryptographyAssociatedRequestIAssociationStore`1INonceStoreIRelyingPartyApplicationStoreCheckAuthRequestILogDotNetOpenId.LoggersLog4NetLoggerAttributeValuesIDirectMessageChannelDirectMessageHttpChannelNoDiscoveryIdentifierAuthenticationResponseShimDotNetOpenId.InteropTypeElementUriUtilUtilFunc`2DelayedToString`1SignatoryPrimeGeneratorBaseMono.Math.Prime.GeneratorSequentialSearchPrimeGeneratorBaseNextPrimeFinderIProviderEndpointIXrdsProviderEndpointServiceEndpointAssertionMessageConstantsAuthenticationLevelsRequestParametersResponseParametersProviderSecuritySettingsElementXrdElementAssociationRelyingPartyTypeNonceStoreRequestAttributeRequestAuthenticationResponseSnapshotDiffieHellmanUtilDHShaYadisDiscoveryResultHtmlParserStringsClaimsRequestIEncodableEncodableResponsePolicyResponseXrdsDocumentEncodeEventArgsHttpEncodingAssociationHmacShaAssociationHmacShaWellKnownAttributesPersonPreferencesNameCompanyBirthDateContactPhoneHomeAddressWorkAddressIMWebMediaImagesStoreConfigurationElement`1UriIdentifierDemandLevelTokenUntrustedWebResponseStoreResponseGendersRelyingPartySecuritySettingsProviderSectionProviderSecuritySettingsIOpenIdRelyingPartyOpenIdRelyingPartyShimContentTypesDiffieHellmanGenderAssociationMemoryStore`1ApplicationMemoryStoreConfidenceFactorMono.Math.PrimeDiffieHellmanManagedUntrustedWebRequestMockRequestResponseISetupRequiredAuthenticationResponseDHParametersOpenIdExceptionIAuthenticationRequestAuthenticationStatusAuthenticationResponseTraceLoggerIIncomingExtensionsIOutgoingExtensionsExtensionArgumentsManagerUriElementEncodingTypePrimalityTestPrimalityTestsProtocolVersionProtocolQueryParametersQueryArgumentsErrorCodesSessionTypesSignatureAlgorithmsModesIsValidValuesFetchRequestAuthenticationPoliciesProviderSessionPlainTextProviderSessionDiffieHellmanProviderSessionFaultyRequestFailedAuthenticationResponseWhiteBlackListElementWhiteBlackListCollectionAuthenticationRequestModeAuthenticationRequestIndirectMessageRequestAssociationsLoggerCheckIdRequestProtocolMessagesNoOpLoggerRelyingPartySectionmscorlibSystemObjectEnumSystem.ConfigurationConfigurationElementMulticastDelegateConfigurationSectionIComparable`1TKeyUriTRMarshalByRefObjectEventArgsSystem.Security.CryptographyAsymmetricAlgorithmValueTypeExceptionIDisposableConfigurationElementCollectionassociationStoreKeyget_Signatoryset_SignatoryEncoderRequestUrlSystem.Collections.GenericIDictionary`2Queryget_Protocolset_Protocolget_DefaultProviderEndpointget_DefaultRequestUrlSystem.Collections.SpecializedNameValueCollectionget_DefaultQuery.ctorget_Endpointset_Endpointget_Settingsset_SettingsrequestProcessedrequestget_RequestdecodeRequestPrepareUnsolicitedAssertionget_HttpApplicationStoregetProviderEndpointFromContextget_Configuration<Signatory>k__BackingField<Protocol>k__BackingField<Endpoint>k__BackingField<Settings>k__BackingFieldDefaultProviderEndpointDefaultRequestUrlDefaultQueryEndpointSettingsHttpApplicationStoreConfigurationvalue__LooseOpenId11OpenId20GetBytesSystem.IOStreamGetDictionarynewLineCharactersillegalKeyCharactersillegalValueCharactersSystem.TextEncodingtextEncodingget_ConformanceLevelset_ConformanceLevelIList`1<ConformanceLevel>k__BackingFieldConformanceLevelget_RelyingPartyset_RelyingPartyget_Providerset_Providerget_Argsset_Args<RelyingParty>k__BackingField<Provider>k__BackingField<Args>k__BackingFieldRelyingPartyProviderArgsget_InvalidatedAssociationHandleget_IsAuthenticationValidInvalidatedAssociationHandleIsAuthenticationValidget_IsDiscoverySecureEndToEndset_IsDiscoverySecureEndToEndop_ImplicitParseTryParseIsValidIEnumerable`1Discoverop_Equalityop_InequalityEqualsGetHashCodeTrimFragmentTryRequireSsl<IsDiscoverySecureEndToEnd>k__BackingFieldIsDiscoverySecureEndToEndminimumHashBitLengthDefaultmaximumHashBitLengthRPDefaultmaximumHashBitLengthOPDefaultminimumHashBitLengthget_MinimumHashBitLengthset_MinimumHashBitLengthmaximumHashBitLengthget_MaximumHashBitLengthset_MaximumHashBitLengthIsAssociationInPermittedRangeMinimumHashBitLengthMaximumHashBitLengthrequireSslConfigNameminimumRequiredOpenIdVersionConfigNameminimumHashBitLengthConfigNamemaximumHashBitLengthConfigNameCreateSecuritySettingsget_RequireSslset_RequireSslget_MinimumRequiredOpenIdVersionset_MinimumRequiredOpenIdVersionRequireSslMinimumRequiredOpenIdVersionDEFAULT_LENWouldReturnNegVallengthdatasmallPrimesop_Additionop_Subtractionop_Modulusop_Divisionop_Multiplyop_LeftShiftop_RightShiftRandomNumberGeneratorrngget_RnggenRandomrandomizebitCounttestBitsetBitclearBitLowestSetBitgetBytesop_GreaterThanop_LessThanop_GreaterThanOrEqualop_LessThanOrEqualCompareToStringNormalizeCleargcdmodInversemodPowisProbablePrimeNextHightestPrimegenPseudoPrimeIncr2RngNegativeZeroPositivemodconstantBarrettReductionMultiplyDifferencePowEvenPowOddPowEvenModTwoPowOddModTwoPowInverseToMontReduceAddSameSignSubtractMinusEqPlusEqSingleByteDivideInPlaceDwordModDwordDivDwordDivModmultiByteDivideLeftShiftRightShiftMultiplyByDwordMultiplyMod2p32pmodSquarePositiveget_TypeUriget_AdditionalSupportedTypeUrisTypeUriAdditionalSupportedTypeUrisSerializeDeserializeInitializeJavaScriptDatabirthDateRawNullable`1DateTimebirthDateSystem.Text.RegularExpressionsRegexbirthDateValidatortypeUriToUseget_Nicknameset_Nicknameget_Emailset_EmailSystem.Net.MailMailAddressget_MailAddressget_FullNameset_FullNameget_BirthDateset_BirthDateget_BirthDateRawset_BirthDateRawget_Genderset_Genderget_PostalCodeset_PostalCodeget_Countryset_Countryget_Languageset_LanguageSystem.GlobalizationCultureInfocultureget_Cultureset_Cultureget_TimeZoneset_TimeZoneDotNetOpenId.Extensions.IExtension.get_TypeUriDotNetOpenId.Extensions.IExtension.get_AdditionalSupportedTypeUrisDotNetOpenId.Extensions.IExtensionResponse.SerializeDotNetOpenId.Extensions.IExtensionResponse.DeserializecreateAddFieldJSDotNetOpenId.Extensions.IClientScriptExtensionResponse.InitializeJavaScriptDatasafeEquals<Nickname>k__BackingField<Email>k__BackingField<FullName>k__BackingField<Gender>k__BackingField<PostalCode>k__BackingField<Country>k__BackingField<Language>k__BackingField<TimeZone>k__BackingFieldNicknameEmailFullNameBirthDateRawPostalCodeCountryLanguageCultureTimeZoneDotNetOpenId.Extensions.IExtension.TypeUriDotNetOpenId.Extensions.IExtension.AdditionalSupportedTypeUrisSystem.NetHttpStatusCodeget_CodeWebHeaderCollectionget_Headersget_BodySendCodeHeadersBodyset_Codeset_Headersset_Bodyget_EncodableMessageset_EncodableMessageget_IndirectMessageAsRequestUri<Code>k__BackingField<Headers>k__BackingField<Body>k__BackingField<EncodableMessage>k__BackingFieldEncodableMessageIndirectMessageAsRequestUriget_IsResponseReadyget_ResponseAddResponseExtensionGetExtensionTypeIsResponseReadyget_Queryset_Queryget_Modeget_OutgoingExtensionsset_OutgoingExtensionsget_IncomingExtensionsset_IncomingExtensionsIsOpenIdRequestCreateRequestget_RelyingPartyVersionCreateResponseInvalidateResponseresponseDotNetOpenId.Provider.IRequest.get_ResponsegetExtension<Query>k__BackingField<OutgoingExtensions>k__BackingField<IncomingExtensions>k__BackingFieldModeOutgoingExtensionsIncomingExtensionsRelyingPartyVersionDotNetOpenId.Provider.IRequest.ResponseStorequeryencoderDirectMessageChannelCreateRequestsShouldParameterBeStrippedFromReturnToUrlget_isAuthenticationResponseReadyget_EncoderComparison`1endpointOrderget_EndpointOrderset_EndpointOrderget_DefaultEndpointOrdergetEndpointPrecedenceOrderByServiceTypeget_EndpointFilterset_EndpointFilterSettings_RequireSslChanged<EndpointFilter>k__BackingFieldisAuthenticationResponseReadyEndpointOrderDefaultEndpointOrderEndpointFilterInvokeIAsyncResultAsyncCallbackBeginInvokeEndInvokeGetCallbackArgumentGetCallbackArgumentsget_ClaimedIdentifierget_FriendlyIdentifierForDisplayget_Statusget_ExceptionClaimedIdentifierFriendlyIdentifierForDisplayStatusTimeSpanget_MaximumAuthenticationAgeset_MaximumAuthenticationAgeget_PreferredPoliciesset_PreferredPoliciesget_PreferredAuthLevelTypesset_PreferredAuthLevelTypesDotNetOpenId.Extensions.IExtensionRequest.SerializeDotNetOpenId.Extensions.IExtensionRequest.DeserializeSerializePoliciesSerializeAuthLevelsFindIncomingAliasesConcatenateListOfElementsGetUniqueItems<MaximumAuthenticationAge>k__BackingField<PreferredPolicies>k__BackingField<PreferredAuthLevelTypes>k__BackingFieldMaximumAuthenticationAgePreferredPoliciesPreferredAuthLevelTypesIfPossibleIfAlreadyEstablishedNeverXrdNamespaceXrdsNamespaceSystem.XmlSystem.Xml.XPathXPathNavigatorget_Nodeset_Nodeget_ParentNodeset_ParentNodeXmlNamespaceManagerget_XmlNamespaceResolverset_XmlNamespaceResolver<Node>k__BackingField<ParentNode>k__BackingField<XmlNamespaceResolver>k__BackingFieldNodeParentNodeXmlNamespaceResolverinitializeAssociationget_DHset_DHget_Associationset_AssociationgetDecodedget_SecondAttemptset_SecondAttempt<DH>k__BackingField<Association>k__BackingField<SecondAttempt>k__BackingFieldDHSecondAttemptInsufficientForLevel1Level1Level2Level3Level4aliasFormatDictionary`2typeUriToAliasMapaliasToTypeUriMapGetAliasSetAliasAssignAliasesSetPreferredAliasesWhereNotSetResolveAliasTryResolveAliasget_AliasesIsAliasUsedIsAliasAssignedToassignNewAliasAliasesKeyValueFormContentTypeFormPostFormatGetToPostThresholdEncodegetSizeOfPayloadCreate301RedirectResponseCreateFormPostResponsesignatoryRequestExtensionsreadWriteTimeoutConfigNametimeoutConfigNamemaximumBytesToReadConfigNamemaximumRedirectionsConfigNamewhitelistHostsConfigNameblacklistHostsConfigNamewhitelistHostsRegexConfigNameblacklistHostsRegexConfigNameget_ReadWriteTimeoutset_ReadWriteTimeoutget_Timeoutset_Timeoutget_MaximumBytesToReadset_MaximumBytesToReadget_MaximumRedirectionsset_MaximumRedirectionsget_WhitelistHostsset_WhitelistHostsget_BlacklistHostsset_BlacklistHostsget_WhitelistHostsRegexset_WhitelistHostsRegexget_BlacklistHostsRegexset_BlacklistHostsRegexReadWriteTimeoutTimeoutMaximumBytesToReadMaximumRedirectionsWhitelistHostsBlacklistHostsWhitelistHostsRegexBlacklistHostsRegexwildcardDetectionPatternUriBuildersafeUriBuilderToStringuriget_DomainWildcardset_DomainWildcardget_Hostget_Schemeget_Portget_AbsolutePathget_PathAndQueryget_NoWildcardUriget_UriWithWildcardChangedToWww_top_level_domainsget_IsSaneContains<DomainWildcard>k__BackingFieldDomainWildcardHostSchemePortAbsolutePathPathAndQueryNoWildcardUriUriWithWildcardChangedToWwwIsSaneGetResponseCreateget_RelyingPartyEndpointset_RelyingPartyEndpointsupportedServiceTypeUrisprotocol<RelyingPartyEndpoint>k__BackingFieldRelyingPartyEndpointList`1attributesProvidedget_AttributesAddAttributeGetAttributecontainsAttributeget_UpdateUrlSupportedget_UpdateUrlset_UpdateUrlSerializeAttributesDeserializeAttributesparseAliases<UpdateUrl>k__BackingFieldAttributesUpdateUrlSupportedUpdateUrlxriSchemexriResolverProxyTemplateGlobalContextSymbolsget_OriginalXriset_OriginalXriget_CanonicalXriset_CanonicalXriIsValidXricanonicalizeXrixriResolverProxyget_XrdsUrldownloadXrds<OriginalXri>k__BackingField<CanonicalXri>k__BackingFieldOriginalXriCanonicalXriXrdsUrlget_Xrdget_Priorityget_UriElementsget_TypeElementsget_TypeElementUrisget_ProviderLocalIdentifierCompareToXrdPriorityUriElementsTypeElementsTypeElementUrisProviderLocalIdentifierRandomStaticget_AssociationHandleset_AssociationHandle<AssociationHandle>k__BackingFieldAssociationHandleStoreAssociationGetAssociationRemoveAssociationClearExpiredAssociationsget_SecretSigningKeyTryStoreNonceClearExpiredNoncesSecretSigningKeyDebugDebugFormatIFormatProviderInfoInfoFormatWarnWarnFormatErrorErrorFormatFatalFatalFormatget_IsDebugEnabledget_IsInfoEnabledget_IsWarnEnabledget_IsErrorEnabledget_IsFatalEnabledIsDebugEnabledIsInfoEnabledIsWarnEnabledIsErrorEnabledIsFatalEnabledlog4netlog4netLoggerInitializeget_isLog4NetPresentcreateLoggerisLog4NetPresentset_TypeUriget_Valuesset_Values<TypeUri>k__BackingField<Values>k__BackingFieldValuesSendDirectMessageAndGetResponsewrappedIdentifierget_Successfulget_ExceptionMessageSuccessfulExceptionMessageget_UriCreateQueryStringAppendQueryArgsUriBuilderToStringWithImpliedPortsDefaultNamespaceget_DotNetOpenIdVersionNameValueCollectionToDictionaryDictionaryToNameValueCollectionGetQueryFromContextNVCGetQueryOrFormFromContextNVCGetQueryOrFormFromContextGetRequestUrlFromContextSystem.WebHttpResponseApplyHeadersToResponseGetRequiredArgGetRequiredArgAllowEmptyValueGetOptionalArgGetRequiredBase64ArgGetOptionalBase64ArgGetRequiredIdentifierArgGetRequiredUriArgGetOptionalRealmArgSystem.Web.UIPageGetResolvedRealmArrayEqualsjavascriptStaticStringEscapingGetSafeJavascriptValueFindBestVersionFirstOrDefaultWhereSystem.CollectionsIEnumerableOfTypeCountAreSequencesEquivalentKeyValuePair`2KVDotNetOpenIdVersionobjtoStringsmartAssociationLifetimedumbSecretLifetimestoreVerifyCreateAssociationInvalidateget_Confidenceget_PrimalityTestget_TrialDivisionBoundsPostTrialDivisionTestsGenerateNewPrimeConfidenceTrialDivisionBoundsGenerateSearchBaseIsPrimeAcceptableIsExtensionSupportedVersionget_VersionIsTypeUriPresentget_ServicePriorityget_UriPriorityServicePriorityUriPriorityget_ProviderEndpointset_ProviderEndpointget_IsSecureDotNetOpenId.RelyingParty.IProviderEndpoint.get_Uriget_UserSuppliedIdentifierset_UserSuppliedIdentifierset_ClaimedIdentifierset_ProviderLocalIdentifierfriendlyIdentifierForDisplayget_ProviderSupportedServiceTypeUrisset_ProviderSupportedServiceTypeUrisCreateForProviderIdentifierCreateForClaimedIdentifierDotNetOpenId.RelyingParty.IProviderEndpoint.get_VersionTextWriterTextReaderParseFromAuthResponseservicePriorityDotNetOpenId.RelyingParty.IXrdsProviderEndpoint.get_ServicePriorityuriPriorityDotNetOpenId.RelyingParty.IXrdsProviderEndpoint.get_UriPriority<ProviderEndpoint>k__BackingField<UserSuppliedIdentifier>k__BackingField<ClaimedIdentifier>k__BackingField<ProviderLocalIdentifier>k__BackingField<ProviderSupportedServiceTypeUris>k__BackingFieldProviderEndpointIsSecureDotNetOpenId.RelyingParty.IProviderEndpoint.UriUserSuppliedIdentifierProviderSupportedServiceTypeUrisDotNetOpenId.RelyingParty.IProviderEndpoint.VersionDotNetOpenId.RelyingParty.IXrdsProviderEndpoint.ServicePriorityDotNetOpenId.RelyingParty.IXrdsProviderEndpoint.UriPriorityCreatePositiveAssertionCreateNegativeAssertionCreateAssertionCreateUnsolicitedAssertionpape_compatibility_aliasAuthLevelNamespaceDeclarationPrefixnist_compatibility_aliasNistTypeUriPreferredTypeUriToAliasMapMaxAuthAgePreferredAuthPoliciesAuthPoliciesAuthTimeAuthLevelAliasPrefixprotectDownlevelReplayAttacksConfigNameget_ProtectDownlevelReplayAttacksset_ProtectDownlevelReplayAttacksProtectDownlevelReplayAttacksget_Servicesget_XriResolutionStatusCodeget_IsXriResolutionSuccessfulget_CanonicalIDget_IsCanonicalIdVerifiedsearchForServiceTypeUrisget_OpenIdProviderIdentifierServicesget_OpenIdClaimedIdentifierServicesget_OpenIdRelyingPartyReturnToServicesget_ServiceUrisServicesXriResolutionStatusCodeIsXriResolutionSuccessfulCanonicalIDIsCanonicalIdVerifiedOpenIdProviderIdentifierServicesOpenIdClaimedIdentifierServicesOpenIdRelyingPartyReturnToServicesServiceUrisSmartDumbUniqueFragmentLengthallowedCharactersPermissibleDateTimeFormatsget_CreationDateset_CreationDateget_UniqueFragmentset_UniqueFragmentremoteServerOriginget_maximumLifetimeget_Ageget_IsExpiredget_ExpirationDategeneratorgenerateUniqueFragmentConsume<CreationDate>k__BackingField<UniqueFragment>k__BackingFieldCreationDateUniqueFragmentmaximumLifetimeAgeIsExpiredExpirationDateget_IsRequiredset_IsRequiredcountget_Countset_CountRespond<IsRequired>k__BackingFieldIsRequiredcallbackArgumentsset_FriendlyIdentifierForDisplayset_Status<FriendlyIdentifierForDisplay>k__BackingField<Status>k__BackingFieldDiffieHellmanSessionTypesHashAlgorithmLookupGetNameForSizeDEFAULT_GENDEFAULT_MODCreateDiffieHellmanSHAHashXorSecretUnsignedToBase64ensurePositiveGetNameAlgorithmHeaderNameisXrdsDocumentFindYadisDocumentLocationInHtmlMetaTagsget_RequestUriset_RequestUriget_NormalizedUriset_NormalizedUriget_YadisLocationset_YadisLocationSystem.Net.MimeContentTypeget_ContentTypeset_ContentTypeget_ResponseTextset_ResponseTextget_IsXrdsset_IsXrdsget_UsedYadisLocation<RequestUri>k__BackingField<NormalizedUri>k__BackingField<YadisLocation>k__BackingField<ContentType>k__BackingField<ResponseText>k__BackingField<IsXrds>k__BackingFieldRequestUriNormalizedUriYadisLocationResponseTextIsXrdsUsedYadisLocationRegexOptionsflagstagExprstartTagExprattrReheadRehtmlReremovedReHeadTagsSystem.Web.UI.HtmlControlsHtmlControltagMatcherstartTagMatcherSystem.ResourcesResourceManagerresourceManresourceCultureget_ResourceManagerget_AttributeAlreadyAddedget_AttributeTooManyValuesget_BadAssociationPrivateDataget_CallDeserializeBeforeCreateResponseget_CIDVerificationFailedget_ClaimedIdentifierCannotBeSetOnDelegatedAuthenticationget_ClaimedIdentifierMustBeSetFirstget_ClientScriptExtensionPropertyNameCollisionget_ClientScriptExtensionTypeCollisionget_CreateRequestAlreadyCalledget_CurrentHttpContextRequiredget_EncryptionRequiredget_ExpectedBase64OpenIdQueryParameterget_ExpiredNonceget_ExplicitHttpUriSuppliedWithSslRequirementget_ExtensionAlreadyAddedWithSameTypeURIget_ExtensionParameterKeysWithoutPrefixExpectedget_FieldMustBeSignedget_FragmentNotAllowedOnXRIsget_HttpContextRequiredForThisOverloadget_IAssociationStoreRequiredWhenNoHttpContextAvailableget_IdentifierSelectRequiresMatchingIdentifiersget_IncompatibleAssociationAndSessionTypesget_InconsistentAppStateget_InsecureWebRequestWithSslRequiredget_InvalidCharacterInKeyValueFormInputget_InvalidKeyValueFormCharacterMissingget_InvalidNonceget_InvalidOpenIdExtensionParameterValueget_InvalidOpenIdQueryParameterValueget_InvalidOpenIdQueryParameterValueBadBase64get_InvalidSchemeget_InvalidSignatureget_InvalidUriget_InvalidXRDSDocumentget_InvalidXriget_IssuedAssertionFailsIdentifierDiscoveryget_KeyAlreadyExistsget_KeysListAndDictionaryDoNotMatchget_MatchingArgumentsExpectedget_MinimumOPVersionRequirementNotMetget_MissingCanonicalIDElementget_MissingInternalQueryParameterget_MissingOpenIdQueryParameterget_MissingReturnToQueryParameterget_NoRelyingPartyEndpointDiscoveredget_NotSupportedByAuthenticationSnapshotget_OpenIdEndpointNotFoundget_OpenIdTextBoxEmptyget_OperationOnlyValidForSetupRequiredStateget_PrefixWithoutPeriodsExpectedget_ProviderOpenIdVersionUnknownget_ProviderRespondedWithErrorget_ProviderRespondedWithUnrecognizedHTTPStatusCodeget_RealmCausedRedirectUponDiscoveryget_ReplayAttackDetectedget_ResponseNotReadyget_ReturnToArgDifferentFromQueryArgget_ReturnToNotUnderRealmget_ReturnToParamDoesNotMatchRequestUrlget_SregInvalidBirthdateget_TamperingDetectedget_TooManyRedirectsget_TypeMustImplementXget_UnsafeWebRequestDetectedget_UnspecifiedDateTimeKindNotAllowedget_WebRequestFailedget_XriResolutionFailedget_XriResolutionStatusMissingAttributeAlreadyAddedAttributeTooManyValuesBadAssociationPrivateDataCallDeserializeBeforeCreateResponseCIDVerificationFailedClaimedIdentifierCannotBeSetOnDelegatedAuthenticationClaimedIdentifierMustBeSetFirstClientScriptExtensionPropertyNameCollisionClientScriptExtensionTypeCollisionCreateRequestAlreadyCalledCurrentHttpContextRequiredEncryptionRequiredExpectedBase64OpenIdQueryParameterExpiredNonceExplicitHttpUriSuppliedWithSslRequirementExtensionAlreadyAddedWithSameTypeURIExtensionParameterKeysWithoutPrefixExpectedFieldMustBeSignedFragmentNotAllowedOnXRIsHttpContextRequiredForThisOverloadIAssociationStoreRequiredWhenNoHttpContextAvailableIdentifierSelectRequiresMatchingIdentifiersIncompatibleAssociationAndSessionTypesInconsistentAppStateInsecureWebRequestWithSslRequiredInvalidCharacterInKeyValueFormInputInvalidKeyValueFormCharacterMissingInvalidNonceInvalidOpenIdExtensionParameterValueInvalidOpenIdQueryParameterValueInvalidOpenIdQueryParameterValueBadBase64InvalidSchemeInvalidSignatureInvalidUriInvalidXRDSDocumentInvalidXriIssuedAssertionFailsIdentifierDiscoveryKeyAlreadyExistsKeysListAndDictionaryDoNotMatchMatchingArgumentsExpectedMinimumOPVersionRequirementNotMetMissingCanonicalIDElementMissingInternalQueryParameterMissingOpenIdQueryParameterMissingReturnToQueryParameterNoRelyingPartyEndpointDiscoveredNotSupportedByAuthenticationSnapshotOpenIdEndpointNotFoundOpenIdTextBoxEmptyOperationOnlyValidForSetupRequiredStatePrefixWithoutPeriodsExpectedProviderOpenIdVersionUnknownProviderRespondedWithErrorProviderRespondedWithUnrecognizedHTTPStatusCodeRealmCausedRedirectUponDiscoveryReplayAttackDetectedResponseNotReadyReturnToArgDifferentFromQueryArgReturnToNotUnderRealmReturnToParamDoesNotMatchRequestUrlSregInvalidBirthdateTamperingDetectedTooManyRedirectsTypeMustImplementXUnsafeWebRequestDetectedUnspecifiedDateTimeKindNotAllowedWebRequestFailedXriResolutionFailedXriResolutionStatusMissingget_PolicyUrlset_PolicyUrlICollection`1SetProfileRequestFromListassembleProfileFieldsadditionalTypeUristypeUriDeserializedFrom<BirthDate>k__BackingField<PolicyUrl>k__BackingFieldPolicyUrlget_EncodingTypeget_EncodedFieldsget_RedirectUrlEncodedFieldsRedirectUrlPrepareDirectMessagePrepareIndirectMessageget_Fieldsset_Fieldsget_Signedset_Signedget_NeedsSigningget_PreferredAssociationHandleset_PreferredAssociationHandleset_RedirectUrl<Fields>k__BackingField<Signed>k__BackingField<PreferredAssociationHandle>k__BackingField<RedirectUrl>k__BackingFieldFieldsSignedNeedsSigningPreferredAssociationHandleget_ActualPoliciesset_ActualPoliciesauthenticationTimeUtcget_AuthenticationTimeUtcset_AuthenticationTimeUtcget_NistAssuranceLevelset_NistAssuranceLevelget_AssuranceLevelsset_AssuranceLevels<ActualPolicies>k__BackingField<AssuranceLevels>k__BackingFieldActualPoliciesAuthenticationTimeUtcAssuranceLevelsXmlReaderget_XrdElementsCreateServiceEndpointsgenerateOPIdentifierServiceEndpointsgenerateClaimedIdentifierServiceEndpointsFindRelyingPartyReceivingEndpointsfindOPIdentifierServicesfindClaimedIdentifierServicesfindReturnToServicesget_IsXrdResolutionSuccessfulXrdElementsIsXrdResolutionSuccessfulget_Messageset_Message<Message>k__BackingFieldMessageget_minimumUsefulAssociationLifetimeget_HasUsefulLifeRemainingUnixEpochget_Handleset_Handleget_Issuedset_Issuedget_TotalLifeLengthset_TotalLifeLengthget_SecretKeyset_SecretKeySerializePrivateDataget_Expiresget_timeTillExpirationget_SecondsTillExpirationGetAssociationTypeCreateHashercutToSecond<Handle>k__BackingField<Issued>k__BackingField<TotalLifeLength>k__BackingField<SecretKey>k__BackingFieldminimumUsefulAssociationLifetimeHasUsefulLifeRemainingHandleIssuedTotalLifeLengthSecretKeyExpirestimeTillExpirationSecondsTillExpirationHmacShaAssociationTypesGetSecretLengthTryFindBestAssociationIsDHSessionCompatibletypeIdentityBaseHashAlgorithmget_SecretLengthSecretLengthBiographyAliasPrefixFirstLastMiddleSuffixCompanyNameJobTitleWholeBirthDateYearMonthDayOfMonthPreferredHomeWorkMobileFaxStreetAddressLine1StreetAddressLine2CityStateAOLICQMSNYahooJabberSkypeHomepageBlogLinkedInAmazonFlickrDeliciousSpokenNameAudioGreetingVideoGreetingDefaultAspect11Aspect43Aspect34FavIconcustomStoreTypeConfigNameget_TypeNameset_TypeNameget_CustomStoreTypeCreateInstanceOfStoreTypeNameCustomStoreTypeallowedSchemesset_Uriget_SchemeImplicitlyPrependedset_SchemeImplicitlyPrependedisAllowedSchemeTryCanonicalizeIsValidUriDiscoverFromHtml<Uri>k__BackingField<SchemeImplicitlyPrepended>k__BackingFieldSchemeImplicitlyPrependedNoRequestRequireTokenKeyget_Nonceset_NoncecreateHashAlgorithmpersistNoncepersistSignatureverifyEndpointByDiscovery<Nonce>k__BackingFieldDefaultContentEncodingget_ResponseStreamset_ResponseStreamget_StatusCodeset_StatusCodeget_ContentEncodingset_ContentEncodingget_FinalUriset_FinalUriHttpWebResponseReadResponseString<ResponseStream>k__BackingField<StatusCode>k__BackingField<ContentEncoding>k__BackingField<FinalUri>k__BackingFieldResponseStreamStatusCodeContentEncodingFinalUriSuccessModeFailureModeget_Succeededset_Succeededget_FailureReasonset_FailureReason<Succeeded>k__BackingField<FailureReason>k__BackingFieldSucceededFailureReasonsreg_nssreg_ns10sreg_ns11othersreg_compatibility_aliaspolicy_urloptionalrequirednicknameemailfullnamedobgenderpostcodecountrylanguagetimezoneMaleFemalerequireSslEventHandlerRequireSslChangedadd_RequireSslChangedremove_RequireSslChangedOnRequireSslChanged<MinimumRequiredOpenIdVersion>k__BackingFieldsecuritySettingsConfigNamestoreConfigNameget_SecuritySettingsset_SecuritySettingsget_Storeset_Store<ProtectDownlevelReplayAttacks>k__BackingFieldProcessAuthenticationHtmlXHtmlXrdsXmlCreateKeyExchangeDecryptKeyExchangeExportParametersImportParametersFromXmlStringToXmlStringserverAssocsTableGetServerAssocssecretSigningKeynoncesExtraLowLowMediumHighExtraHighProvableget_KeyExchangeAlgorithmget_SignatureAlgorithmDisposeFinalizeGenerateKeym_Pm_Gm_Xm_Disposedm_OAKLEY768m_OAKLEY1024m_OAKLEY1536KeyExchangeAlgorithmSignatureAlgorithmmaximumBytesToReadmaximumRedirectionsSystem.Net.CacheRequestCachePolicyDefaultCachePolicyIdentifierDiscoveryCachePolicyMockRequests.cctorIPAddressisIPv6LoopbackallowableSchemeswhitelistHostswhitelistHostsRegexblacklistHostsblacklistHostsRegexisHostWhitelistedisHostBlacklistedisHostInListisUriAllowablereadDatagetResponseRequestInternal<ReadWriteTimeout>k__BackingField<Timeout>k__BackingFieldget_ClaimedOrProviderIdentifierClaimedOrProviderIdentifierPGXget_Identifierset_IdentifierExtraArgsToReturnSystem.Runtime.SerializationSerializationInfoStreamingContextGetObjectDataget_HasReturnToget_IsDirectMessageDotNetOpenId.IEncodable.get_EncodingType<Identifier>k__BackingFieldHasReturnToIsDirectMessageDotNetOpenId.IEncodable.EncodingTypeAddCallbackArgumentsAddExtensionRedirectToProviderset_Modeget_RedirectingResponseget_ReturnToUrlget_Realmget_IsDirectedIdentityget_ProviderVersionRedirectingResponseReturnToUrlIsDirectedIdentityProviderVersionCanceledFailedSetupRequiredAuthenticatedCallbackArgumentssignedArgumentsget_ReturnToGetExtensionClientScriptparseIdResResponseverifyReturnToverifyDiscoveredInfoMatchesAssertedInfoverifyNonceUnusedverifySignatureverifyFieldsAreSignedverifySignatureByAssociationverifySignatureByProvidercleanQueryForCallbackArgumentsReturnToSystem.DiagnosticsTraceSwitchtraceSwitchget_isSufficientPermissionGrantedisSufficientPermissionGrantedGetExtensionArgumentsContainsExtensionAddExtensionArgumentsisReadModealiasManagerextensionstypeUriToAliasAffinityCreateIncomingExtensionsCreateOutgoingExtensionsGetArgumentsToSendget_ServiceServiceNoneIndirectMessageGetSPPRoundsRabinMillerTestSmallPrimeSppTestget_Immediateget_IsReturnUrlDiscoverableget_IsDelegatedIdentifierget_LocalIdentifierset_LocalIdentifierSetClaimedIdentifierFragmentget_IsAuthenticatedset_IsAuthenticatedImmediateIsReturnUrlDiscoverableIsDelegatedIdentifierLocalIdentifierIsAuthenticatedV10V11V20v10v11v20AllVersionsDetectDetectFromDirectResponseget_ProtocolVersionXmlNamespaceQueryDeclaredNamespaceVersionClaimedIdentifierServiceTypeURIOPIdentifierServiceTypeURIRPReturnToTypeURIClaimedIdentifierForOPIdentifierHtmlDiscoveryProviderKeyHtmlDiscoveryLocalIdKeyopenidopenidnpMaximumUserAgentAuthenticationTimeMaximumAllowableTimeSkewaddPrefixnsreturn_tomodeerrorerror_codeidentityop_endpointresponse_nonceclaimed_idexpires_inassoc_typeassoc_handlesession_typeis_validsigsigneduser_setup_urlinvalidate_handledh_modulusdh_gendh_consumer_publicdh_server_publicenc_mac_keymac_keyErrorCodeSessionTypeUnsupportedTypeget_Allget_AllDiffieHellmanDH_SHA1DH_SHA256DH_SHA384DH_SHA512NoEncryptionget_BestAllAllDiffieHellmanBestHMAC_SHA1HMAC_SHA256HMAC_SHA384HMAC_SHA512cancelid_rescheckid_immediatecheckid_setupcheck_authenticationassociatesetup_neededTrueFalseattributesRequestedparseAliasListPhishingResistantMultiFactorPhysicalMultiFactorsessionCreateAssociationTypeHintsAnswerget_SessionTypeCreateSessionconsumerPublicKeydhsessionTypeset_Response<Response>k__BackingFieldset_Exception<Exception>k__BackingFieldnameConfigNameget_Nameset_NameCreateNewElementGetElementKeyget_KeysAsStringsget_KeysAsRegexsKeysAsStringsKeysAsRegexssignaturesignedFieldssignedKeyOrderSetupassociationPreferenceendpointget_protocolCreateInternalCreateSinglefilterAndSortEndpointsSystem.Collections.ObjectModelReadOnlyCollection`1selectEndpointgetAssociationget_ReturnToArgsset_ReturnToArgsset_Realmset_ReturnToUrlDotNetOpenId.RelyingParty.IAuthenticationRequest.get_Provider<ReturnToArgs>k__BackingField<Mode>k__BackingField<Realm>k__BackingField<ReturnToUrl>k__BackingFieldReturnToArgsDotNetOpenId.RelyingParty.IAuthenticationRequest.Providerset_EncodedFields<EncodedFields>k__BackingFieldassocsSetGetRemoveClearExpiredfacadeinitializeFacadeisAuthenticatedset_ImmediateisReturnUrlDiscoverableset_IsDirectedIdentityset_IsDelegatedIdentifierlocalIdentifierclaimedIdentifierset_ReturnToget_CancelUrlget_SetupUrl<Immediate>k__BackingField<IsDirectedIdentity>k__BackingField<IsDelegatedIdentifier>k__BackingField<ReturnTo>k__BackingFieldCancelUrlSetupUrlHttpKeyValueFormvalueproviderEndpointrequestUrlrelyingPartydictionaryconformanceLevelkeyOrderproviderargsisDiscoverySecureEndToEndidentifierresultSystem.Runtime.InteropServicesOutAttributeid1id2secureIdentifierisProviderassociationTypesignlenbinumberinDatauiulbi1bi2ishiftValbitsbitNumvalradixcharSetoexpnnotUsedxabmmPrimebigsmalldfxOffsetxLenyyOffsetyLendOffsetyOffestwkSpacemodulusauthenticationRequestfieldstypeUrisregpropertyNameoneothercodeheadersbodyencodableMessageextensionextensionTypeuserSuppliedIdentifierrealmreturnToUrlparameterNamesendereobjectmethodcallbackkeypoliciespreferredAuthLevelTypesaliasesvalueslistnodeparentNodedocumentaliastypeUrispreferredTypeUriToAliasesmessageencodablerealmUrlrealmUriBuilderurlallowRedirectsallowNoSessionrelyingPartyEndpointattributeattributeTypeUriattributesxriserviceElementparentdistinguishingFactorassochandlenonceexceptionformatParamArrayAttributearg0arg1arg2loggertypeElementbuildernvcdictpagefirstsecondelementOfsequencepredicatesequence1sequence2pairsmultiLineElementstsigned_pairsContextproviderLocalIdentifierproviderSupportedServiceTypeUrisproviderIdentifierextensionUriwriterreaderse1se2xrdElementpcreationuniqueFragmentisRequiredcopyFromnamehashSizeInBitshasherkeyExencMacKeyinputBytesalgorithmgetNamehtmlrequestUriinitialResponsefinalResponsetagNamecloseTagstag_namefieldNamesrequestLevellevelbaseRedirectUrlpreferredAssociationHandlexrdsNavigatorxmlopIdentifiersecrettotalLifeLengthissuedexpiresprivateDatakeysToSignkeyLookupPrefixdateTimesecretLengthminimumHashSizeInBitsmaximumHashSizeInBitsrequireMatchingDHSessionTypedefaultValuerequireSslDiscoverycanonicalUriforceHttpsDefaultSchemeschemePrependeduriBuildertokenresponseStreamresponseUristatusCodecontentTypecontentEncodingformalgNameincludePrivateparametersxmlStringincludePrivateParametersbitlenlkeygengsecretLencheckInputdisposingiphoststringListregexListrespbufferacceptTypescachePolicyavoidSendingExpect100ContinueoriginalRequestUriinnerExceptioninfocontextargumentsstatustokenEndpointresponseEndpointverifyMessageSignaturefieldsThatAreSignedfieldsThatShouldBeSignedextensionTypeUriincludeOpenIdPrefixuriElementserviceconfidencefragmentqueryBitsversionserviceTypeURIsaddPrefixTooriginalaliasListelementcreateNewAssociationsAsNeededserviceEndpointsendpointscreateNewAssociationIfNeededreceivingUrlassociationSystem.ReflectionAssemblyVersionAttributeAssemblyTitleAttributeAssemblyDescriptionAttributeAssemblyConfigurationAttributeAssemblyCompanyAttributeAssemblyProductAttributeAssemblyCopyrightAttributeAssemblyTrademarkAttributeAssemblyCultureAttributeNeutralResourcesLanguageAttributeCLSCompliantAttributeComVisibleAttributeGuidAttributeSystem.Runtime.CompilerServicesInternalsVisibleToAttributeSystem.Security.PermissionsSecurityPermissionAttributeSecurityActionWebPermissionAttributeDebuggableAttributeDebuggingModesCompilationRelaxationsAttributeRuntimeCompatibilityAttributeDebuggerDisplayAttributeCompilerGeneratedAttributeArgumentNullExceptionEnvironmentget_NewLineHttpContextget_CurrentInvalidOperationExceptionHttpApplicationStateget_Applicationget_ItemLockset_ItemUnLockset_FragmentDebuggerBrowsableAttributeDebuggerBrowsableStateStringget_KeysCopyToArgumentExceptionMemoryStreamStreamWriterset_NewLineIEnumerator`1GetEnumeratorTrimIndexOfAnyget_CurrentCultureFormatWriteWriteLineIEnumeratorMoveNextToArrayStreamReaderget_LengthCharSplitInt32IsWhiteSpaceAddReadLineget_BaseStreamSeekOriginSeekReadByteUTF8EncodingContainsKeyStringComparisonSerializableAttributeIsNullOrEmptyBooleanConfigurationPropertyAttributeUInt32ArrayCloneget_CharsFormatExceptionArgumentOutOfRangeExceptionArithmeticExceptionIndexOutOfRangeExceptionByteBufferBlockCopyConcatObsoleteAttribute<PrivateImplementationDetails>{9818C8FC-11C3-40CC-B58F-7F45A1CBF878}__StaticArrayInitTypeSize=3132$$method0x60005dc-1RuntimeHelpersRuntimeFieldHandleInitializeArrayget_HasValueget_Valueget_InvariantCultureIsMatchGetCultureInfoget_TwoLetterISOLanguageNameIndexOfSubstringGetValueOrDefaultTryGetValueStringBuilderAppendset_LengthSystem.Xml.SerializationXmlIgnoreAttributeget_OutputStreamFlushCloseEndStartsWithget_KeyActivatorCreateInstanceRuntimeTypeHandleGetTypeFromHandleIsAssignableFromSystem.ComponentModelEditorBrowsableAttributeEditorBrowsableStateget_Pathset_PathEmptyNameObjectCollectionBaseHttpRequestget_ApplicationPathEndsWith<get_DefaultEndpointOrder>b__0CS$<>9__CachedAnonymousMethodDelegate1Doubleget_TotalSecondsFromSeconds<GetUniqueItems>d__0`1System.Collections.Generic.IEnumerable<T>.GetEnumeratorSystem.Collections.IEnumerable.GetEnumerator<>2__currentSystem.Collections.Generic.IEnumerator<T>.get_CurrentSystem.Collections.IEnumerator.ResetResetSystem.IDisposable.Dispose<>1__state<>l__initialThreadIdSystem.Collections.IEnumerator.get_Current<>3__list<itemsSeen>5__1<item>5__2<>7__wrap3<>m__Finally4System.Collections.Generic.IEnumerator<T>.CurrentSystem.Collections.IEnumerator.CurrentDebuggerHiddenAttributeSystem.ThreadingThreadget_CurrentThreadget_ManagedThreadIdNotSupportedExceptionXmlNameTableget_NameTableget_MajorConvertToInt32FromBase64StringKeyCollectionHttpResponseHeaderget_AbsoluteUriHttpUtilityHtmlEncodeAppendFormatConfigurationManagerGetSectionSectionInformationget_SectionInformationset_AllowLocationPositiveTimeSpanValidatorAttributeIntegerValidatorAttributeConfigurationCollectionAttributeMatch<.ctor>b__0MatchEvaluatorGroupCollectionget_GroupsGroupCaptureReplaceUriFormatExceptionset_HostXmlExceptionUriSchemeHttps<get_Protocol>b__0EnumeratorUriKindTryCreate<DeserializeAttributes>d__1System.Collections.Generic.IEnumerable<DotNetOpenId.Extensions.AttributeExchange.AttributeValues>.GetEnumeratorSystem.Collections.Generic.IEnumerator<DotNetOpenId.Extensions.AttributeExchange.AttributeValues>.get_Current<>3__fields<aliasManager>5__2<alias>5__3<att>5__4<count>5__5<countSent>5__6<countString>5__7<>7__wrap8<>m__Finally9System.Collections.Generic.IEnumerator<DotNetOpenId.Extensions.AttributeExchange.AttributeValues>.Current__StaticArrayInitTypeSize=6$$method0x60001a4-1__StaticArrayInitTypeSize=10$$method0x60005f6-1IXmlNamespaceResolverSelectSingleNodeXPathItemget_ValueAsIntXPathNodeIteratorSelectSort<get_TypeElements>d__0System.Collections.Generic.IEnumerable<DotNetOpenId.Yadis.TypeElement>.GetEnumeratorSystem.Collections.Generic.IEnumerator<DotNetOpenId.Yadis.TypeElement>.get_Current<>4__this<node>5__1<>7__wrap2System.Collections.Generic.IEnumerator<DotNetOpenId.Yadis.TypeElement>.CurrentCopyAssemblyLoadFileNotFoundExceptionLogManagerGetLoggerReadToEndWebExceptionUrlEncode<UriBuilderToStringWithImpliedPorts>b__0GetExecutingAssemblyGetKeyget_Urlget_RawUrlget_QueryStringParseQueryStringget_RequestTypeget_FormAddHeader<>c__DisplayClass1foundWildcard<GetResolvedRealm>b__0ControlResolveUrlInsert<Where>d__3`1<>3__sequence<>3__predicate<item>5__4<>7__wrap5<>m__Finally6<OfType>d__9`1<item>5__a<>7__wrapb<>7__wrapc<>m__Finallyd<>c__DisplayClass11`2<ToString>b__10<>c__DisplayClass14`1<ToString>b__13AppendLineJoinToBase64StringRNGCryptoServiceProviderget_UtcNowFromDaysFromMinutesget_AuthorityTrimEndUnescapeDataString<Deserialize>b__0<>c__DisplayClass4serviceTypeUri<ToString>b__2extget_OriginalStringAddRange<get_OpenIdProviderIdentifierServices>b__0<get_OpenIdClaimedIdentifierServices>b__2CS$<>9__CachedAnonymousMethodDelegate3<get_OpenIdRelyingPartyReturnToServices>b__4CS$<>9__CachedAnonymousMethodDelegate5<get_ServiceUris>d__6System.Collections.Generic.IEnumerable<DotNetOpenId.Yadis.UriElement>.GetEnumeratorSystem.Collections.Generic.IEnumerator<DotNetOpenId.Yadis.UriElement>.get_Current<service>5__7<uri>5__8<>7__wrap9<>m__Finallya<>m__FinallycSystem.Collections.Generic.IEnumerator<DotNetOpenId.Yadis.UriElement>.CurrentToUniversalTimeNextget_HashSizeComputeHash<.cctor>b__0CS$<>9__CachedAnonymousMethodDelegate4<.cctor>b__1<.cctor>b__2CS$<>9__CachedAnonymousMethodDelegate6<.cctor>b__3CS$<>9__CachedAnonymousMethodDelegate7SHA512ManagedSHA384ManagedSHA256ManagedSHA1Managed__StaticArrayInitTypeSize=129$$method0x600062d-1get_MediaTypeStringReaderReadXmlNodeTypeget_NodeTypeget_NamespaceURIHtmlMetaget_HttpEquivget_Content<HeadTags>d__0`1<>3__html<match>5__1<tagName>5__2<match2>5__3<text>5__4<text2>5__5<regex>5__6<match3>5__7<beginning>5__8<length>5__9<match4>5__a<headTag>5__bget_TagNameget_Successget_IndexHtmlDecodeAttributeCollectionNextMatchSystem.CodeDom.CompilerGeneratedCodeAttributeDebuggerNonUserCodeAttributeReferenceEqualsget_AssemblyGetString$$method0x6000362-1DateTimeKindget_KindDateTimeStylesAddNamespaceXPathDocumentCreateNavigator<get_XrdElements>d__0System.Collections.Generic.IEnumerable<DotNetOpenId.Yadis.XrdElement>.GetEnumeratorSystem.Collections.Generic.IEnumerator<DotNetOpenId.Yadis.XrdElement>.get_Current<node>5__2<>7__wrap4<>m__Finally5System.Collections.Generic.IEnumerator<DotNetOpenId.Yadis.XrdElement>.Current<generateOPIdentifierServiceEndpoints>b__8CS$<>9__CachedAnonymousMethodDelegate9<generateOPIdentifierServiceEndpoints>d__aSystem.Collections.Generic.IEnumerable<DotNetOpenId.RelyingParty.ServiceEndpoint>.GetEnumeratorSystem.Collections.Generic.IEnumerator<DotNetOpenId.RelyingParty.ServiceEndpoint>.get_Current<>3__opIdentifier<service>5__b<uri>5__c<>7__wrapd<>m__Finallye<>7__wrapf<>m__Finally10System.Collections.Generic.IEnumerator<DotNetOpenId.RelyingParty.ServiceEndpoint>.Current<generateClaimedIdentifierServiceEndpoints>d__13<>3__claimedIdentifier<service>5__14<uri>5__15<>7__wrap16<>m__Finally17<>7__wrap18<>m__Finally19<generateClaimedIdentifierServiceEndpoints>d__1c<>3__userSuppliedIdentifier<service>5__1d<uri>5__1e<claimedIdentifier>5__1f<>7__wrap20<>m__Finally21<>7__wrap22<>m__Finally23<FindRelyingPartyReceivingEndpoints>d__26System.Collections.Generic.IEnumerable<DotNetOpenId.Provider.RelyingPartyReceivingEndpoint>.GetEnumeratorSystem.Collections.Generic.IEnumerator<DotNetOpenId.Provider.RelyingPartyReceivingEndpoint>.get_Current<service>5__27<uri>5__28<>7__wrap29<>m__Finally2a<>7__wrap2b<>m__Finally2cSystem.Collections.Generic.IEnumerator<DotNetOpenId.Provider.RelyingPartyReceivingEndpoint>.Current<findOPIdentifierServices>d__2fSystem.Collections.Generic.IEnumerable<DotNetOpenId.Yadis.ServiceElement>.GetEnumeratorSystem.Collections.Generic.IEnumerator<DotNetOpenId.Yadis.ServiceElement>.get_Current<xrd>5__30<service>5__31<>7__wrap32<>m__Finally33<>7__wrap34<>m__Finally35System.Collections.Generic.IEnumerator<DotNetOpenId.Yadis.ServiceElement>.Current<findClaimedIdentifierServices>d__38<xrd>5__39<service>5__3a<>7__wrap3b<>m__Finally3c<>7__wrap3d<>m__Finally3e<findReturnToServices>d__41<xrd>5__42<service>5__43<>7__wrap44<>m__Finally45<>7__wrap46<>m__Finally47get_ASCIIMathMaxget_TicksGetTypeHMACSHA1NullCryptoStreamICryptoTransformCryptoStreamModeget_HashToFileTimeUtc<.cctor>b__4secretKeyCS$<>9__CachedAnonymousMethodDelegatec<.cctor>b__5CS$<>9__CachedAnonymousMethodDelegated<.cctor>b__6CS$<>9__CachedAnonymousMethodDelegatee<.cctor>b__7CS$<>9__CachedAnonymousMethodDelegatef<.cctor>b__8CS$<>9__CachedAnonymousMethodDelegate10<.cctor>b__9CS$<>9__CachedAnonymousMethodDelegate11<.cctor>b__aCS$<>9__CachedAnonymousMethodDelegate12<.cctor>b__bCS$<>9__CachedAnonymousMethodDelegate13HMACSHA512HMACSHA384HMACSHA256<isAllowedScheme>b__0sSchemeDelimiterPredicate`1FindIndex<isAllowedScheme>b__3UriSchemeHttpToLowerInvariantget_IsAbsoluteUriHtmlLinkEscapeget_Href<Discover>b__6seget_Fragmentset_Schemeset_PortWriteByteFlushFinalBlockset_PositionWebResponseget_ResponseUriGetEncodingget_PositionDelegateCombineInterfaceTypeAttributeComInterfaceTypeProgIdAttributeClassInterfaceAttributeClassInterfaceTypeComSourceInterfacesAttributeCryptoConfigCreateFromNameNotImplementedExceptionMonitorEnterExitValueCollection__StaticArrayInitTypeSize=96$$method0x6000438-1__StaticArrayInitTypeSize=128$$method0x6000438-2__StaticArrayInitTypeSize=192$$method0x6000438-3$$method0x6000439-1$$method0x6000439-2$$method0x6000439-3$$method0x600043a-1$$method0x600043a-2$$method0x600043a-3CryptographicExceptionHttpWebRequestget_DefaultCachePolicyHttpRequestCachePolicyHttpRequestCacheLevelGetAddressBytes<>c__DisplayClass2<isUriAllowable>b__1reasonget_DnsSafeHostSystem.Net.SocketsAddressFamilyget_AddressFamilyget_ContentLengthMinGetResponseStreamWebRequestset_AllowAutoRedirectget_TotalMillisecondsset_KeepAliveset_CachePolicyset_Acceptset_ContentLengthset_MethodServicePointget_ServicePointset_Expect100ContinueGetRequestStreamStructLayoutAttributeLayoutKindGetValueAddValueDebuggerStepThroughAttributeSystem.SecurityPermissionSetPermissionStateKeyContainerPermissionIPermissionAddPermissionReflectionPermissionReflectionPermissionFlagRegistryPermissionSecurityPermissionSecurityPermissionFlagFileIOPermissionFileIOPermissionAccessset_AllFilesDemandSecurityExceptionTraceTraceInformationTraceWarningTraceErrorget_TraceVerboseget_TraceInfoget_TraceWarningget_TraceError<Detect>b__0<Detect>b__1<Detect>b__2get_MinorInt64GCSuppressFinalize<get_KeysAsStrings>d__0System.Collections.Generic.IEnumerable<System.String>.GetEnumeratorSystem.Collections.Generic.IEnumerator<System.String>.get_Current<element>5__1System.Collections.Generic.IEnumerator<System.String>.Current<get_KeysAsRegexs>d__7System.Collections.Generic.IEnumerable<System.Text.RegularExpressions.Regex>.GetEnumeratorSystem.Collections.Generic.IEnumerator<System.Text.RegularExpressions.Regex>.get_Current<element>5__8<>7__wrapa<>m__FinallybSystem.Collections.Generic.IEnumerator<System.Text.RegularExpressions.Regex>.Current<CreateInternal>d__0System.Collections.Generic.IEnumerable<DotNetOpenId.RelyingParty.AuthenticationRequest>.GetEnumeratorSystem.Collections.Generic.IEnumerator<DotNetOpenId.RelyingParty.AuthenticationRequest>.get_Current<>3__relyingParty<>3__realm<>3__returnToUrl<>3__serviceEndpoints<>3__createNewAssociationsAsNeeded<endpoints>5__1<failedAssociationEndpoints>5__2<endpoint>5__3<association>5__4<endpoint>5__5<authRequest>5__6<>7__wrap7<>m__Finally8System.Collections.Generic.IEnumerator<DotNetOpenId.RelyingParty.AuthenticationRequest>.Current<>c__DisplayClass10<filterAndSortEndpoints>b__dep<filterAndSortEndpoints>b__eDotNetOpenId.RelyingParty.login_success (lock).pngDotNetOpenId.RelyingParty.spinner.gifDotNetOpenId.RelyingParty.dotnetopenid_16x16.gifDotNetOpenId.RelyingParty.login_success.pngDotNetOpenId.RelyingParty.openid_login.gifDotNetOpenId.RelyingParty.login_failure.pngDotNetOpenId.Strings.resourcesstore!providerEndpointrequestUrlqueryEReceived OpenID {0} request.{1}{2}relyingParty#claimedIdentifierlocalIdentifierOPreparing unsolicited assertion for {0}kDotNetOpenId.Provider.OpenIdProvider.AssociationStoredictionarykeyOrder
\nprovider	argscDirect response from provider lacked the {0} key.€Direct response from provider for key {0} was '{1}' rather than '{2}'.identifierrequireSsl9minimumRequiredOpenIdVersion)minimumHashBitLength)maximumHashBitLengthGOnly positive integers are allowed.valueOOperation would return a negative value!bi1 out of range!bi2 out of range
bitNumI0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ=charSet length less than radixcharSetYThere is no such thing as radix one notationradix01x out of rangeNo inverse!Khttp://openid.net/extensions/sreg/1.1typeUriToUseyyyy-MM-dd=Simple Registration birthdate '{0}' could not be parsed into a DateTime and may not include month and/or day information.  Setting BirthDate property to null.-+authenticationRequestdobcountryemailfullname
genderFMlanguagenicknamepostcodetimezone€™Simple Registration response included invalid value for openid.sreg.dob: {0}{0}: {1},{ })^\d\d\d\d-\d\d-\d\d$headers	bodyextensionType%Request.Mode = {0}realmreturnToUrl/oDotNetOpenId.RelyingParty.RelyingParty.AssociationStoremax_auth_age/preferred_auth_policiesauth_level.ns.5preferred_auth_level_typesWhttp://specs.openid.net/extensions/pape/1.0 typeUrialias3preferredTypeUriToAliasesalias{0}messageMSending direct message response:{0}{1}1application/x-openid-kvf?Sending indirect message:{0}{1}7Cannot encode response: {0}%Redirecting to {0}c	<input type="hidden" name="{0}" value="{1}" />

„
<html>
<body onload="var btn = document.getElementById('submit_button'); btn.disabled = true; btn.value = 'Login in progress'; document.getElementById('openid_message').submit()">
<form id="openid_message" action="{0}" method="post" accept-charset="UTF-8" enctype="application/x-www-form-urlencoded" onSubmit="var btn = document.getElementById('submit_button'); btn.disabled = true; btn.value = 'Login in progress'; return true;">
{1}
	<input id="submit_button" type="submit" value="Continue" />
</form>
</body>
</html>
signatoryMMust have a store to sign this requestAX fetchAX store	PAPE	sregAdotNetOpenId/untrustedWebRequest!readWriteTimeouttimeout%maximumBytesToRead'maximumRedirectionswhitelistHostsblacklistHosts'whitelistHostsRegex'blacklistHostsRegexrealmUrl^(\w+://)\*\.	httphttpsrealmUriBuilder	www.localhost?*.comedugovintmilnetorgbiz	info	name
museum	coop	aeroacadaeafagaialamanaoaqarasatauawazbabbbdbebfbgbhbibjbmbnbobrbsbtbvbwbybzcacccdcfcgchcickclcmcncocrcucvcxcyczdedjdkdmdodzeceeegeheresetfifjfkfmfofrgagdgegfggghgiglgmgngpgqgrgsgtgugwgyhkhmhnhrhthuidieiliminioiqirisitjejmjojpkekgkhkikmknkpkrkwkykzlalblclilklrlsltlulvlymamcmdmgmhmkmlmmmnmompmqmrmsmtmumvmwmxmymznancnenfngninlnonpnrnunzompapepfpgphpkplpmpnprpsptpwpyqarerorurwsasbscsdsesgshsisjskslsmsnsosrstsvsysztctdtftgthtjtktmtntotptrtttvtwtzuaugukumusuyuzvavcvevgvivnvuwfwsyeytyuzazmzwKSending direct message to {0}: {1}{2}€×Security requirements and protocol combination knock out all possible association types.  Dumb mode forced.assoc_typesession_type€—Requesting association with {0} (assoc_type = '{1}', session_type = '{2}').€‹Unable to determine the version of OpenID the Relying Party supports.attribute9http://openid.net/srv/ax/1.0	modeupdate_urltype.
count.value.{0}.{1}
value.mFailed to parse count.{0} value to a positive integer.EMissing value for attribute '{0}'.OIllegal characters in alias name '{0}'.fetch_responseuhttps://xri.net/{0}?_xrd_r=application/xrd%2Bxml;sep=false;https=truexri(
xri://@priorityxrd:URIxrd:Typexrd:LocalID#openid10:DelegateGAssociatedRequest.AssocHandle = {0}log4netDotNetOpenId
fieldsSReceived direct response from {0}: {1}{2}wFull response from provider (where KVF was expected):{0}{1}oFailure decoding Key-Value Form response from provider.KFailure while connecting to provider.#wrappedIdentifierresponsebuilder+^(https?://[^:]+):\d+?PublicKeyToken=2780ccd10d57b246{0} ({1})privateofficialGETContent-Typekeyfirst
second	nullsequence1sequence2	{0}: {1}{2}[{
<NULL>		}, {]{,\\\\t
\r…
\u0085( 
\u2028) 
\u2029'	\x27"	\x22&	\x26<	\x3c>	\x3e=	\x3d€ÅNo associaton found with assoc_handle {0}. Setting invalidate_handle and creating new Association.gNo assoc_handle supplied. Creating new association.€‰Signature verification failed. No association with handle {0} found oExpected signature is '{0}'. Actual signature is '{1}' gFor Smart associations, the provider must be given.{{}{assoc_handleQAssociation {0} expired or not in store.?Invalidating association '{0}'.ContextAproviderSupportedServiceTypeUris€Unable to determine the version of OpenID the Provider supports.€Cannot lookup extension support on a rehydrated ServiceEndpoint.extension'ClaimedIdentifier: 3ProviderLocalIdentifier: %ProviderEndpoint: !OpenID version: %Service Type URIs:	(unavailable)requestGCreated positive assertion for {0}.GCreated negative assertion for {0}.€‰http://csrc.nist.gov/publications/nistpubs/800-63/SP800-63V1_0_2.pdf	nist;protectDownlevelReplayAttacksxrd:Servicexrd:Status	codexrd:CanonicalIDcidverifiedxrd:Service[#xrd:Type/text()='' or Z€¹!"#$%'()*+,-./0123456789:;=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~)yyyy-MM-ddTHH:mm:ssZstore_request
valuescopyFrom€¥encMacKey's length ({0}) does not match the length of the hashing algorithm ({1}).€‘Invalid input passed to EnsurePositive. Array must have something in it.inputBytesalgorithmgetName_Discovery on insecure identifier '{0}' aborted.text/html+application/xhtml+xml)application/xrds+xmlqUnsafe OpenId URL detected ({0}).  Request aborted.  {1}€‡An XRDS response was received from GET at user-supplied identifier.X-XRDS-Locationu{0} found in HTTP header.  Preparing to pull XRDS from {1}€…{0} found in HTML Http-Equiv tag.  Preparing to pull XRDS from {1}€‰XRDS document at insecure location '{0}'.  Aborting YADIS discovery.text/xmlxri://$xrds	XRDS
endtagattrnameattrval
(?:{0}	|{0})ƒA
# Starts with the tag name at a word boundary, where the tag name is
# not a namespace
<{0}\b(?!:)
    
# All of the stuff up to a ">", hopefully attributes.
(?<attrs>[^>]*?)
    
(?: # Match a short tag
    />
    
|   # Match a full tag
    >
    
    (?<contents>.*?)
    
    # Closed by
    (?: # One of the specified close tags
        </?{1}\s*>
    
    # End of the string
    |   \Z
    
    )
    
)
    ‚
# Starts with the tag name at a word boundary, where the tag name is
# not a namespace
<{0}\b(?!:)
    
# All of the stuff up to a ">", hopefully attributes.
(?<attrs>[^>]*?)
    
(?: # Match a short tag
    />
    
|   # Match a full tag
    >
    )
    ‚Ù
# Must start with a sequence of word-characters, followed by an equals sign
(?<attrname>(\w|-)+)=

# Then either a quoted or unquoted attribute
(?:

 # Match everything that's between matching quote marks
 (?<qopen>["\'])(?<attrval>.*?)\k<qopen>
|

 # If the value is not quoted, match up to whitespace
 (?<attrval>(?:[^\s<>/]|/(?!>))+)
)

|

(?<endtag>[<>])
    	head	htmlu<!--.*?-->|<!\[CDATA\[.*?\]\]>|<script\b[^>]*>.*?</script>)DotNetOpenId.Strings+AttributeAlreadyAdded-AttributeTooManyValues3BadAssociationPrivateDataGCallDeserializeBeforeCreateResponse+CIDVerificationFailedkClaimedIdentifierCannotBeSetOnDelegatedAuthentication?ClaimedIdentifierMustBeSetFirstUClientScriptExtensionPropertyNameCollisionEClientScriptExtensionTypeCollision5CreateRequestAlreadyCalled5CurrentHttpContextRequired%EncryptionRequiredEExpectedBase64OpenIdQueryParameterExpiredNonceSExplicitHttpUriSuppliedWithSslRequirementIExtensionAlreadyAddedWithSameTypeURIWExtensionParameterKeysWithoutPrefixExpected#FieldMustBeSigned1FragmentNotAllowedOnXRIsEHttpContextRequiredForThisOverloadgIAssociationStoreRequiredWhenNoHttpContextAvailableWIdentifierSelectRequiresMatchingIdentifiersMIncompatibleAssociationAndSessionTypes)InconsistentAppStateCInsecureWebRequestWithSslRequiredGInvalidCharacterInKeyValueFormInputGInvalidKeyValueFormCharacterMissingInvalidNonceIInvalidOpenIdExtensionParameterValueAInvalidOpenIdQueryParameterValueSInvalidOpenIdQueryParameterValueBadBase64InvalidScheme!InvalidSignatureInvalidUri'InvalidXRDSDocumentInvalidXriOIssuedAssertionFailsIdentifierDiscovery!KeyAlreadyExists?KeysListAndDictionaryDoNotMatch3MatchingArgumentsExpectedCMinimumOPVersionRequirementNotMet3MissingCanonicalIDElement;MissingInternalQueryParameter7MissingOpenIdQueryParameter;MissingReturnToQueryParameterANoRelyingPartyEndpointDiscoveredINotSupportedByAuthenticationSnapshot-OpenIdEndpointNotFound%OpenIdTextBoxEmptyOOperationOnlyValidForSetupRequiredState9PrefixWithoutPeriodsExpected9ProviderOpenIdVersionUnknown5ProviderRespondedWithError_ProviderRespondedWithUnrecognizedHTTPStatusCodeARealmCausedRedirectUponDiscovery)ReplayAttackDetected!ResponseNotReadyAReturnToArgDifferentFromQueryArg+ReturnToNotUnderRealmGReturnToParamDoesNotMatchRequestUrl)SregInvalidBirthdate#TamperingDetected!TooManyRedirects%TypeMustImplementX1UnsafeWebRequestDetectedCUnspecifiedDateTimeKindNotAllowed!WebRequestFailed'XriResolutionFailed5XriResolutionStatusMissing€OpenIdProfileRequest.SetProfileRequestFromList: Unrecognized field name '{0}'.policy_urloptionalrequiredANickname = '{0}' 

Email = '{1}' 

FullName = '{2}' 

Birthdate = '{3}'

Gender = '{4}'

PostalCode = '{5}'

Country = '{6}'

Language = '{7}'

TimeZone = '{8}'5http://openid.net/sreg/1.05http://openid.net/sreg/1.1protocolbaseRedirectUrl7Response.NeedsSigning = {0}5ResponseField[{0}] = '{1}'auth_policiesauth_timeauth_level.ihttp://schemas.openid.net/pape/policies/2007/06/noneKInvalid format for {0} parameter: {1}xrd'xri://$xrd*($v*2.0)	xrdsopenid10/xrds:XRDS%/xrds:XRDS/xrd:XRD/xrd:XRDMTotal services discovered in XRDS: {0}
handle
secretprivateDataassociationTypesecretLengthtypeIdentity	typeurirel\b}Skipping endpoint data because local id is badly formed ({0}).QHTML discovery found a service endpoint.wSkipping HTML discovered endpoint because it is not secure.YHTML discovery failed to find any endpoints.€ƒSkipping HTML discovery because XRDS contained service endpoints.tokenrequestUriresponseStreamISO-8859-1!RequestUri = {0}#ResponseUri = {0}!StatusCode = {0}#ContentType = {0}+ContentEncoding = {0}Headers:	{0}: {1}Response:-store_response_failure-store_response_successerror+dotNetOpenId/providersecurityQMono.Security.Cryptography.DiffieHellmanEGenerating new secret signing key.%1.2.840.113549.1.3!Missing P value.!Missing G value.#Invalid bit size.=Rejecting URL {0} because {1}.mRejecting URL {0} because it uses a disallowed scheme.3it is a loopback address.Qit does not use an IPv4 or IPv6 address..]it does not contain a period in the host name.WRejected URL {0} because it is blacklisted.%originalRequestUriCapplication/x-www-form-urlencoded	POST5OpenIdException: {0}{1}{2})OpenIdException: {0}IdentifiergVerified positive authentication assertion for: {0}_Negative authentication assertion received: {0}]OpenID authentication response received:{0}{1}GThe provider returned an error: {0}-Verifying return_to...wVerifying assertion matches identifier discovery results...€Provider asserted an identifier that requires (re)discovery to confirm.9Verifying nonce is unused...€£Passing signature back to Provider for verification (no association available)...9Association with {0} expiredKVerifying signature by association...openid.: 
OpenID'OpenID Trace Switch!extensionTypeUriarguments	pape€«The Rabin-Miller test can not be executed in a way such that its results are provableconfidenceversionQueryserviceTypeURIs;OpenID Authentication {0}.{1}7http://openid.net/xmlns/1.09http://openid.net/signon/1.0openid.serveropenid.delegate9http://openid.net/signon/1.1op_endpointresponse_nonceerror_codeAhttp://specs.openid.net/auth/2.0Ohttp://specs.openid.net/auth/2.0/signonOhttp://specs.openid.net/auth/2.0/serverehttp://specs.openid.net/auth/2.0/identifier_selectUhttp://specs.openid.net/auth/2.0/return_to!openid2.provider!openid2.local_idno-encryptionDH-SHA256DH-SHA384DH-SHA512HMAC-SHA256HMAC-SHA384HMAC-SHA512setup_needednsreturn_totrust_rootidentityclaimed_idexpires_inis_validsig
signeduser_setup_url#invalidate_handledh_modulus
dh_gen%dh_consumer_public!dh_server_publicenc_mac_keymac_key!unsupported-typeDH-SHA1HMAC-SHA1
cancel
id_res#checkid_immediatecheckid_setup)check_authenticationassociate	truefalseif_available€¿Attribute Exchange extension did not provide any aliases in the if_available or required lists.unlimited[ could not be parsed into a positive integer.;Type URI definition of alias  is missing.uIllegal characters found in Attribute Exchange alias list.fetch_request1Association {0} created.EAssociateRequest._assoc_type = {0}yNo matching association found. Returning invalidate_handle. €‹

CheckAuthRequest._sig = '{0}'

CheckAuthRequest.AssocHandle = '{1}'endpoint-userSuppliedIdentifier€§OpenId argument "{0}" found in return_to URL.  This can corrupt an OpenID response.kPerforming discovery on user-supplied identifier: {0}€ƒCreating authentication request for user supplied Identifier: {0}Realm: {0}Return To: {0}€…Failed to create association with {0}.  Skipping to next endpoint.€±Now generating requests for Provider endpoints that failed initial association attempts.endpoints€ƒSome endpoints were filtered out.  Total endpoints remaining: {0}wFiltering and sorting of endpoints did not affect the list.€¡After filtering and sorting service endpoints, this is the new prioritized list:yNo state store, so the first endpoint available is selected.€¹Endpoint #{0} (1-based index) responded to an association request.  Selecting that endpoint.€ßAll endpoints failed to respond to an association request.  Selecting first endpoint to try to authenticate to.€­Initial association attempt failed, but will retry with Provider-suggested parameters.€ÙProvider responded with contradicting association parameters.  Requested [{0}, {1}] but got [{2}, {3}] back.CAssociation with {0} established.[Association attempt with {0} provider failed.receivingUrlassociation€­Realm {0} contained return_to URL {1} which contains a wildcard, which is not allowed._Relying party discovery at URL {0} failed.  {1}€ƒCancel is not an appropriate response to immediate mode requests.K

CheckIdRequest.Immediate = '{0}'

CheckIdRequest.Realm = '{1}'

CheckIdRequest.Identity = '{2}' 

CheckIdRequest._mode = '{3}' 

CheckIdRequest.ReturnTo = '{4}' 

3dotNetOpenId/relyingPartyüȘÃÌ@µE¡Ëøx·z\V4à‰°?_Õ
:€°€¼€¼‚‚DjDotNetOpenId.Provider.OpenIdProvider.AssociationStore €ü €ü€ˆ= ‚\ ‚\A  €¼4A €¼4=   è è\ X \ P€˜ 
€¼4ä€ü‚\è(€ü(‚\A((è(X
€¼4ä
 =
 =E
I   =M( `= ` `   =	 =`(`((=  ((     	 Q           ‚\(requireSsl8minimumRequiredOpenIdVersion(minimumHashBitLength(maximumHashBitLength à ‚X ‚X(‚X	NOperation would return a negative value	 0	 , ,	,  	 	 ,	,,,,,,	,	,,UU,U U 	  	 ,	,, 0, 	 	 ,, ,,,,,U0ÿÿÿÿ, ,	,			,,,	,,0,,,,	,,		,,,												,	 Q(Q
 =X =h =hY]a  e Y]	 Y]	 Yü
 Yüi i iLLYü(e(Y]	(Yü(i m q(m(q( mqd m q d dmqd(d P D0 lu(P   ‚@ ‚@	=\T T l‚@((‚@(TnDotNetOpenId.RelyingParty.RelyingParty.AssociationStore€Ä€Ø
 €ÄA €Ä= ‚( €˜
 ‚( €˜ ‚(  Q‚( €˜ Q‚( €˜ Q‚( h h €ˆy	 y
 y	y
 d d€Ä à %‚Èdà(h(€ˆ	(y	y(d€Ä(à‚È   }€ }  Du ‚, 1( (‚,(1 =‚( =X	 Y€…
 Y€… M MMM€„€„=QMY€…M	(Y€…(Mt&xri://$xrd*($v*2.0)xri://$xrds €‰x €‰ €‰ x x € €€‰x€(€‰(x(€ `=ø ø ø | |  €  € ø|€ (ø(|(€ €€€‘  Q= 0application/x-openid-kvf„
<html>
<body onload="var btn = document.getElementById('submit_button'); btn.disabled = true; btn.value = 'Login in progress'; document.getElementById('openid_message').submit()">
<form id="openid_message" action="{0}" method="post" accept-charset="UTF-8" enctype="application/x-www-form-urlencoded" onSubmit="var btn = document.getElementById('submit_button'); btn.disabled = true; btn.value = 'Login in progress'; return true;">
{1}
	<input id="submit_button" type="submit" value="Continue" />
</form>
</body>
</html>
 Tdd	€‘l readWriteTimeouttimeout$maximumBytesToRead&maximumRedirectionswhitelistHostsblacklistHosts&whitelistHostsRegex&blacklistHostsRegex€” €… €… ‚  ‚ €”(€…(‚ ^(\w+://)\*\.€˜€˜€˜ €•€• 
 Q€¤
€ `
€ `| |(| 	€™€Ô	 Q€Ô €Ô €Ô€‘Q€ÔQ€Ô=	(Q€Ôxri://thttps://xri.net/{0}?_xrd_r=application/xrd%2Bxml;sep=false  p Q€¬	 €‰0 0 Y	 Q‚D	 Q€è  €°(0(Y	(Q‚D	(Q€è(€´ | | |  8€È`= (  1    	 €DáÔ&X!€¡ €¡€Ì  ==    h	 €‰€°	=A€•=DotNetOpenId
=A
A==q€¥
== ==€˜=	€•€©
‚\€ô‚\QQ€ôQQ€ôQ€ôQ€­€­QQQ€±
QQ 
 }€ }
 €ô	€ô€…	€¼4 €¼4 h =M
 |4	 |4 4 ‚ ‚L , ,(‚(‚L , ,0 u €µ(€µ     YY    ‚\ YY  YY   YY @ €¹€½
= 	Yh  	h‚¼h‚¼
P€˜  Vhttp://specs.openid.net/extensions/pape/1.0papeauth_level.ns.nist€ˆhttp://csrc.nist.gov/publications/nistpubs/800-63/SP800-63V1_0_2.pdfmax_auth_age.preferred_auth_policies4preferred_auth_level_typesauth_policiesauth_timeauth_level.:protectDownlevelReplayAttacks	 €‰p	 Q€° Q€°€ô‚\	(Q€°4€¸!"#$%'()*+,-./0123456789:;=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ ] ] ]€Á €À](]  €Ô ‚,‚,L	€Å‚\‚\ø€Åø €Å€ô‚\
€ô‚\€ÅX-XRDS-Location	TÄÐ ÐÐ €É €É€É(€É€Í9ƒ@
# Starts with the tag name at a word boundary, where the tag name is
# not a namespace
<{0}\b(?!:)
    
# All of the stuff up to a ">", hopefully attributes.
(?<attrs>[^>]*?)
    
(?: # Match a short tag
    />
    
|   # Match a full tag
    >
    
    (?<contents>.*?)
    
    # Closed by
    (?: # One of the specified close tags
        </?{1}\s*>
    
    # End of the string
    |   \Z
    
    )
    
)
    ‚
# Starts with the tag name at a word boundary, where the tag name is
# not a namespace
<{0}\b(?!:)
    
# All of the stuff up to a ">", hopefully attributes.
(?<attrs>[^>]*?)
    
(?: # Match a short tag
    />
    
|   # Match a full tag
    >
    )
    
Qaa€Õ€Õii€Õi È È €ÙÈ È L	``È(È ‚H(‚Hh‚\h‚\	 ‚\ €™	 €™€™(€™	 Y€€
 Y€€	(Y€€ €Ý	 Q0 QÄ Q 	 Q€¤	(Q0 €…]
|]€… 
 ‚\ =M €Å]]€…(
„€‚\€…€€…‚\‚\YY‚\ „€…„€ô€ÅBhttp://axschema.org/person/genderFhttp://axschema.org/media/biographyBhttp://axschema.org/pref/languageBhttp://axschema.org/pref/timezoneNhttp://axschema.org/namePerson/friendly<http://axschema.org/namePersonJhttp://axschema.org/namePerson/prefixHhttp://axschema.org/namePerson/firstFhttp://axschema.org/namePerson/lastJhttp://axschema.org/namePerson/middleJhttp://axschema.org/namePerson/suffix@http://axschema.org/company/nameBhttp://axschema.org/company/title:http://axschema.org/birthDateNhttp://axschema.org/birthDate/birthYearPhttp://axschema.org/birthDate/birthMonthLhttp://axschema.org/birthDate/birthdayBhttp://axschema.org/contact/emailRhttp://axschema.org/contact/phone/defaultLhttp://axschema.org/contact/phone/homeThttp://axschema.org/contact/phone/businessLhttp://axschema.org/contact/phone/cellJhttp://axschema.org/contact/phone/fax\http://axschema.org/contact/postalAddress/homephttp://axschema.org/contact/postalAddressAdditional/homeJhttp://axschema.org/contact/city/homeLhttp://axschema.org/contact/state/homePhttp://axschema.org/contact/country/homeVhttp://axschema.org/contact/postalCode/homedhttp://axschema.org/contact/postalAddress/businessxhttp://axschema.org/contact/postalAddressAdditional/businessRhttp://axschema.org/contact/city/businessThttp://axschema.org/contact/state/businessXhttp://axschema.org/contact/country/business^http://axschema.org/contact/postalCode/businessDhttp://axschema.org/contact/IM/AIMDhttp://axschema.org/contact/IM/ICQDhttp://axschema.org/contact/IM/MSNHhttp://axschema.org/contact/IM/YahooJhttp://axschema.org/contact/IM/JabberHhttp://axschema.org/contact/IM/SkypeNhttp://axschema.org/contact/web/defaultHhttp://axschema.org/contact/web/blogPhttp://axschema.org/contact/web/LinkedinLhttp://axschema.org/contact/web/AmazonLhttp://axschema.org/contact/web/FlickrRhttp://axschema.org/contact/web/DeliciousHhttp://axschema.org/media/spokennamePhttp://axschema.org/media/greeting/audioPhttp://axschema.org/media/greeting/videoNhttp://axschema.org/media/image/defaultPhttp://axschema.org/media/image/aspect11Phttp://axschema.org/media/image/aspect43Phttp://axschema.org/media/image/aspect34Nhttp://axschema.org/media/image/favicontype u (uÄÄ 
	€• 8 8	 8 €À	Ì€À€Å€À	€À€À8(8ISO-8859-1 E E
 ۇE qmEE(E,store_response_success,store_response_failureJhttp://openid.net/extensions/sreg/1.14http://openid.net/sreg/1.04http://openid.net/sreg/1.1sregpolicy_urloptionalrequirednickname
emailfullnamedobgenderpostcodecountrylanguagetimezoneMF€å €å‚Xsecurity
store , , À€¼4 À€¼4(,(À€¼4  €ätext/html*application/xhtml+xml(application/xrds+xmltext/xmlø  ‚  ‚  ü€‘‚´ ‚´	€™8‚ €´	   ,,,
 €´,,€…€é‚€í€Ù€Ù€Ùa	€Ùa€Ù€Ùa€á
Ð€áÐ	ÐÐÐ€éÐ€é€Ù	€Ùa Ð }€ Ð}8http://openid.net/srv/ax/1.0  =1  =  1 
 = 1	 €ñ€õ l ‚¨ ‚¨ €˜ (‚¨(€˜( ‚,= u H D‚0=`‚0=`=`==€Ä`==‚\|==€ù	 =€„€‘€‘‚@=‚@‚\	 = €° ‚D(€°‚H ,‚
 },‚€,‚,‚ Y Y(Y ‚`	€™‚\‚\€µ‚\‚X‚\=‚\€µ‚`‚d‚h‚l‚p‚t‚x	€™@	 Q@ @ @	€™	(Q@hhttp://schemas.openid.net/pape/policies/2007/06/none€„http://schemas.openid.net/pape/policies/2007/06/phishing-resistantxhttp://schemas.openid.net/pape/policies/2007/06/multi-factor€Šhttp://schemas.openid.net/pape/policies/2007/06/multi-factor-physical‚ˆ
= h €‘‚ˆ d 11name 
 
 Qa(Qa‚¨
 €˜`Q‚¬ `€˜Q‚¬ `€˜Q‚¬ `€˜€™Q`€ý`|` €˜€˜ =
€‘| |€Ì1Yx ( (
 À€Ä À€Ä((
(À€Ä E QMHEndpoint: {Endpoint}, OpenId Request: {Query.ContainsKey("openid.mode")}
À€¼4€¼4
\m u ‚4
m€¼4m€• }€Ù€±=	 €Ù€Ù  EIQ	 ‘‘  	€ ‰‘€‘   

¥
™€‘=OpenId: {Protocol.Version} ‚XOJIsAuthenticationValid: {IsAuthenticationValid}, OpenId: {Protocol.Version} ­à 
requireSslTQDefaultValue5minimumRequiredOpenIdVersionTQDefaultValueV10-minimumHashBitLengthTQDefaultValue -maximumHashBitLengthTQDefaultValue 		 ,	0,ÁÁ	,										,	4‚Ð	Áå,			,	,,0,0Á,,				
,,						,													,												,														,												

,								
					,		,		
						
								,	,	,,'			,,					,,,,	,					,			,	
																																							,,,						,,,,,4,,,,0+Use ClaimsRequest.CreateResponse() instead.Y] €]] i  Yü€‘YüYü Y]Yü é
éL €¥ €•-(Mode: {Mode}, OpenId: {Protocol.Version}
‚\‘
\‚$Q€±‘€±€± €™dh€±‘€±=‘

uõul_ZisAuthenticationResponseReady: {isAuthenticationResponseReady}, stateless: {Store == null}À€Ä ýQ‚(‘‚(
‘‚(
‚( •€•A€‘•5 ‚‚\‚$	 
Y a
YYYYYYYYYYYYYYYYYYym€ÄY€…	€…€…!pY€…Y€…‘‘ 
 €%€‘€„Y€…Y€…€…
‘
€€…
 
€„Y€…€™‘€„€±‘€±
é‘Q‘M€™‘((‚‚Ô	‚Ô€Ù€™‚Ô	‚Ô ‚ ‚	€ …€……	Å‘‘€±‘€± ‚! ‚%‚HTqm‚H€±‘€±q€• é q‰é€±‘€±h€‘l
€‘l ‚12readWriteTimeoutTQDefaultValue00:00:00.800%timeoutTQDefaultValue00:00:10+maximumBytesToReadTQDefaultValueTMinValue,maximumRedirectionsTQDefaultValue
TMinValue*whitelistHostsTIsDefaultCollection u83DotNetOpenId.Configuration.WhiteBlackListCollection*blacklistHostsTIsDefaultCollection/whitelistHostsRegexTIsDefaultCollection/blacklistHostsRegexTIsDefaultCollection‚A‚E ‚I ‚M‚E­ 	Tp‚YQ€¤€˜YTMode: {Args["openid.mode"]}, {Args["openid.assoc_type"]}, OpenId: {Protocol.Version}€‘‚\ø‚ :5RelyingPartyReceivingEndpoint: {RelyingPartyEndpoint}‚\	€ô‚\€™€Ô	 ‚]‚]€Ô€Ô€Ô‚]€Ô€‘€‘Q€Ô‘€ÔM €„€Ô‘€Ô
‚a€Ô‘€Ô
 ‘€Ô€Ô €Ô‘(€Ô‚Ø	‚Ü€ÝEÐp€¬‚à	 €‰‚e
€‰Y€™‚D	 ‚m‚e€™‚D€‰•5Q€è‘€è
 ‘€è€è €è€°•5(€è‚ä‚m€‰•5€‰!YYYYYY
ÁÁ
‚\€‘‘‚q€¡
=Ð…‚}VQThis class acts as a COM Server and should not be called directly from .NET code. éé€±‘€±é‚E€Í‚q€‘A€±‘€± AA‚‚A m ‚%	•5 ‚U€˜ ‚A	€•‚è ‚…‚… €± é éé€±‚…€™‚\‚]‚\Q‘
€ô‚\‚\‚\‚]‚\‘‘Q	€ô‚ì	‚ì€ô‚ì	‚ì€ô‘€­‚ð	‚ð‚ð	‚ð•5‘‘Q€± Q€±	‚ô=€Ù€±
Q€±‘€±	€±	 é$=é€±‘€±	‚ô€ôQ€±€øQ€±‚ô	 Q‚ø  éé‘‘‚ø€ôQ€øQ	‚ø	€‘€ø€ô |] €…]‚\‚‰€
€…]€…|	,		mhClaimedIdentifier: {ClaimedIdentifier}, ProviderEndpoint: {ProviderEndpoint}, OpenId: {Protocol.Version} €¬Ä
‘@€µ‚\€ô‚\€µ€ô‚\€µ
€µ  ‚\€µ €±l€±l€ô€±l

€±l#é€±l€ô€±l‚ü	 Q	‚\YhYY€™€¤€™€¤€¤hè3protectDownlevelReplayAttacksTQDefaultValue€™€°€™€°€‰•5€‰!é‚\€™€°€‰‚]‚\•5Q‚D‘‚D
 ‘‚D‚D ‚D0	‘€°	‘‚D(‚DƒQ€°‘€° ­]€€…€…€…	€…]]	]]€… 8€Ô‘€Ô =
L€ÅLLL ÁƒLÐ…ÐT€Ý€½ ‚¡€Ý
‚¥Q‚¥‘‚¥‚¥‘‚¥‚Aƒ	ƒ ‚A
 ‚A ‚M ‚© ‚Aƒ	ƒ é €Í
é@3System.Resources.Tools.StronglyTypedResourceBuilder2.0.0.0 ‚q ‚q€Õ i€‘€‘‘€™	`€‘€±‘€±‘ ‚µ]]uY€€
Y€€]],l€±Y]Y]‘€±‘6
€‘€„€±Y]Y]]]‘‘€±
€‚¹]
]€„Y]‘ €½Q0‘0
 ‘0pƒ€™

€™Q‘
 ‘ƒÄƒ€¬ƒQ€¤‘€¤
 ‘€¤€¤ €¤(€¤ƒ
 ‘€°	‘0ƒ ƒ$ƒ(0‘0I™=+&Handle = {Handle}, Expires = {Expires} 1
€……|


€…€‘‘€Å 

 E‚Í‚Ñ‚Å‚É
]
 ‚µ
„€„„„„„
„„
€ô€Å€Å„„„„„Àu	type‚á‚áƒ,ƒ0
‚候‚å‚]‚å€ÍC‚\ €™‚å‚\‚å‚偂]‚\‚]‚å‚]‚åYY
€ô	€ô€™TpQÄ;6Nonce: {Nonce}, Endpoint: {Endpoint.ClaimedIdentifier} ‰€Å‚Ɂ E‰€Å™8 €™QL{StatusCode} {ContentType.MediaType}: {ReadResponseString().Substring(4,50)}I™

é•5‚í‚í‚í€å
security
store)$00462F34-21BE-456c-B986-B6DDE4DC5CA8 ‚õ)$4D6FB236-1D66-4311-B761-972C12BB85E81,DotNetOpenId.RelyingParty.OpenIdRelyingPartyWQThis class acts as a COM Server and should not be called directly from .NET code. ƒ-(DotNetOpenId.Interop.IOpenIdRelyingParty`T`‚
€‘‚´‚´‚|‚
‚ ƒ
ƒ‚´ ƒ
ƒ‚´‚´‚ƒ‚´‚€™8‚‚]8#€™888‚‚]8‚]8ƒ4ƒ8ƒ<,,,,,‚ ,,,€é ƒ)€™aQa‘aa‘‘a€ô€í ƒ-€ô€íƒ@ƒ- E
Ðƒ1 €é ƒ5 ‚éƒ!E€á‚}€áÐ€…€… ƒ= u.€„System.Security.Permissions.SecurityPermissionAttribute, mscorlib, Version=2.0.0.0, Culture=neutral, PublicKeyToken=b77a5c561934e089€TUSystem.Security.Permissions.SecurityPermissionFlag, mscorlib, Version=2.0.0.0, Culture=neutral, PublicKeyToken=b77a5c561934e089Flags€ u"Use Provider.Version instead.=8Status: {Status}, ClaimedIdentifier: {ClaimedIdentifier}H=‘D
=‚\ AA•5 €™	|€È ƒI ƒQƒQ ƒY ƒe ƒm	ƒEƒi
€‘€‘>‚@€±€±€±‘€±‚…‘€±‚@€±‚…
‚…€‘
€±€‘=€‘€±€‘€‘€±‚…€‘‚…€‘€±‘€±"YYYYYY‚,,,U4,	,,4,	€µ€µ‚\‚\‚]‚\‚X "	‚\‚\‚`‚\‚d‚l‚p‚t€™‚\€™@‚]@@@‚]@,	€‘€™€™€„@€‘‚]@‚]-€™€™€™€„@@‚]
€™faMode: {Mode}, AssocType: {assoc_type}, Session: {session.SessionType}, OpenId: {Protocol.Version}‚$‚\€‘"|h=€±
‘€±
{SessionType}‚\‚$€‘{Exception.Message}nameT
IsRequired ‘‚ ‚œƒD	 ‘a a(aƒH‘
h|UPClaimedIdentifier: {ClaimedIdentifier}, Mode: {Mode}, OpenId: {protocol.Version}AQ•5Q‚¬‘‚¬
 ‘‚¬‚¬ ‚¬Q	€™	‘	‚](‚¬ƒL‚]
‘‚¬€™	 y‚]
0
dd€™€™ƒP‘‚]€ý€™|‚]
|€ -€•€‘€‘|€±‚°‘€±Count = {assocs.Count}	€‘|‚´||‚´‚´	ƒ|	ƒ||||‚´ƒ|€™|‚]|$€™|||‚´ƒ|‚]|€ÌupMode: {Mode}, IsAuthenticated: {IsAuthenticated}, LocalIdentifier: {LocalIdentifier}, OpenId: {Protocol.Version}€¤€˜‚$‚}‘€¤YY€•€‘	€‘€•DotNetOpenIdCopyright ©  2008
en-US)$7d73990c-47c0-4256-9f20-a893add9e289DotNetOpenId.TestTWrapNonExceptionThrows¬.€„System.Security.Permissions.SecurityPermissionAttribute, mscorlib, Version=2.0.0.0, Culture=neutral, PublicKeyToken=b77a5c561934e089T	ExecutionlSystem.Net.WebPermissionAttribute, System, Version=2.0.0.0, Culture=neutral, PublicKeyToken=b77a5c561934e089TConnectPattern	http://.*lSystem.Net.WebPermissionAttribute, System, Version=2.0.0.0, Culture=neutral, PublicKeyToken=b77a5c561934e089TConnectPattern
https://.*¶FLI}aCRSDS9rhàùmìB–Ÿ(‡¶ÓJ.C:\Documents and Settings\dcolive\Desktop\dotnetopenid\src\DotNetOpenId\obj\Release\DotNetOpenId.pdb¼aÞa Ða_CorDllMainmscoree.dllÿ% @€0€HX€èè4VS_VERSION_INFO½ïþ¢ ¢ ?DVarFileInfo$Translation°HStringFileInfo$000004b0D
FileDescriptionDotNetOpenId8FileVersion2.6.0.8354DInternalNameDotNetOpenId.dllHLegalCopyrightCopyright ©  2008LOriginalFilenameDotNetOpenId.dll<
ProductNameDotNetOpenId<ProductVersion2.6.0.8354@Assembly Version2.6.0.8354`ð1
ViewGit