Last commit for bin/OpenMetaverse.StructuredData.dll: d6837f5dc7ac27948f6fbfd1660f0471d202a4c0

update libomv to 59280cfe3e96714151158f4ec7b167af57f60e93 (current head) to hopefully resolve zlib incompatibilities when rendering maptiles with mesh

dahlia [2014-02-23 02:52:59]
update libomv to 59280cfe3e96714151158f4ec7b167af57f60e93 (current head) to hopefully resolve zlib incompatibilities when rendering maptiles with mesh
MZÿÿ¸@€º´	Í!¸LÍ!This program cannot be run in DOS mode.
$PELIbNà!` Ž~ € À@…@~K€ø   H.text”^ ` `.rsrcø€p@@.reloc €@Bp~HP®ðÏ0s(

(o)
*þo*
-rpsz(
rop(-r“p(&(
(
*"(*0(
o+
o)
*"(*0* €s,

,~2~2Žio-
(*0goE4cK½Ô8!o.
*oo-
*io.
oo-
*ro.
oo-
*uo.
oo-
*so.
o
Ži(o-
Žio-
*bo.
oŽi(
	o-
Žio-
*do.
oo-
*lo.
oŽi(o-
Žio-
*t(*t(	*r³psz0Q[o.
oà(
o-
o"
+o/
(o0
-êÞ
,o1
Ü]o.
*$>
0¡{o.
o¾(
o-
oÍ+Qo2
¥	ko.
(3
(4
o5
Ži(
	o-
Žio-
(6
(o0
-¦Þu<,o1
Ü}o.
*%^ƒ0(
o7
/r!pszÒd5G15!.}0YE‚v8°[;•bYEµ‘I8Œl5i.Yl;ë8rrYEJXc{;F8Jsh
8J(%
8>(%
82(((&
8((
	(/
8(s8
(2
8ç((((5
8Æ(((3
(o9
(1
8—(((3
(o9
s:
	Þ&rpsz	(4
+S((;

~<
(=

(>
(?
(3
+(
+(
+rãpsz*›0B((
sÑ+(
oçX2ì](-r7psz*0y	((
s¹+Gk(-r›psz((
(3
	(o9
(
oÃX2µ}(-rûpsz*0.
o7
%
1Ò .ïÒ	.éÒ
.ãÒ
.Ýjo@
&*0 
o7

/*Ò3*jo@
&*0soA
Y
oB
+-oC
(D
	Ñ(D
oE
,X+,o7
%
11Á,1jo@
&*oF
*0 E
oG
/r!psz*0
-*(H

(I
*0--
#ð¿*(J

(K
(L
(M

	*0(N

(O
*0r(P
Ži/Ži+oQ

ropoR
,(*r[poR
-ripoR
-rupoR
,(7*(3
o9
(0*0WropoR
,(3
o5
(*r[poR
-ripoR
-rupoR
,(9*(0*0…o*
,rE
oG
&jo@
&(P
o9
ropoS
,(*r[poS
-ripoS
-
rupoS
,(8*(/*r“psz0sT

(oU
*0	(
*0(
oV
oW
*0sX

("*0(
oV
oW
*0sX

~Y
(%*03()
/sh*ÑT0O'0 !YE£;';8Ô0YEþŽF;3T;º8«i05[;ŠbYEŠ~.~Æi;!8pl;×rYE*%{;;8?sh8P(%8D~3(,1~3Ži/r	psz(%8~4(,1~4Ži/r	psz(%8à(%8Ô~5(,1~5Ži/r	psz(%8¢~6(,1~6Ži/r	psz(%8p(8d(8X$C
	$oZ
$/rkpsz	s[
(\
-rÝpsz(28~]
o^
/r=pszÑ(3r³pszÑ(_
9†CoZ
/r=pszs[
(`
-r'psz@3)oa
/r=psz"(+		(b
+r‘pŒHrÛp(c
sz(58?(*
oa
/rÿpsz
C
oZ

/rÿpszoa
/rÿpszs[
(18Ú'(+(18Ã"(+

(18¬oa
/rÿpsz"(+s:
Þ&rupsz(4+loa
/rÝpsz"(+(d
-rOpsz(3+.( +%(!+r¯pьCr		p(c
sz*£¯0yse
o^
%
1(Ñ-3"Ñof
&oa
&+Ñof
&oa
&o^
%
1	Ñ(_
-ÜoV
(`
-r	poV
(g
sz(&*0se
o^
%
1.Ñ-3(Ñ+3"Ñof
&oa
&+Ñof
&oa
&o^
%
1'Ñ(_
-ÜÑ..ÖÑe.ÐÑE.ÊÑ+.ÄÑ-.¾oV
(h
-rs	poV
(g
sz(/*0XsÑ+.(oç()
/rÓ	pszÑ,.Ñ].((%
1Ñ]3Á/rÓ	psz*0§s¹+z(o.rI
pszo
()
Ñ:.r
pszÑ:.r
psz	(oÃ()
/ropszÑ,.Ñ}.((%
1	Ñ}@rÿÿÿ/ropsz*0jo
E(=gR»à‹8!!oi
*o,	toi
*foi
*ioi
ooj
*roi
ooj
*uoi
ooj
*'oi
o'(.oj
'oi
*boi
rápoj
"oi
ooj
"oi
*doi
"oi
ooj
"oi
*loi
"oi
o"(.oj
"oi
*t(#*t($*rçpsz0?
[oi
oàY
+oâ("/,oi
X1ß]oi
*0˜{oi
o¾Y
oÍ
+U	o2
¥	'oi
(4
'(.oj
'oi
:oi
(6
("/,oi
X	o0
-£Þ	u<,o1
Ü}oi
*a{0€o
E(=gR»à‹$87!oi
*o,	toi
*foi
*ioi
ooj
*roi
ooj
*uoi
ooj
*'oi
o'(.oj
'oi
*boi
rápoj
"oi
ooj
"oi
*doi
"oi
ooj
"oi
*loi
"oi
o"(.oj
"oi
*rYp(g
t(&*rYp(g
t('*rçpsz0‘
ok
oj
[oi
oàY
+Uoâo
.oâo	.ok
rYp(g
oj
oâ(%/,oi
X1§ok
oj
]oi
*0Þok
oj
{ol
o¾Y
oÍ
+~	o2
¥	rYp(g
oj
'oi
(4
'(.oj
'oi
:oi
(6
(%/ok
rYp(g
oj
,ol
X	o0
:wÿÿÿÞ	u<,o1
Üok
oj
}oi
*'´0-+Ñ .	.

.
3oa
&o^
%
0×*0
((
oa
&*0nse
((%
1Ñ(3oa
&+	Ñof
&oa
%
1Ñ(_
,Ñ)3Ý/r_pszoV
(`
-r
psz*0se
8µ9œÑ
	f0	aYE+5	f.:+o	n.>	rYE,M7MB+Kof
&+_of
&+Uof
&+J
of
&+?
of
&+4	of
&+)of
&+Ñof
&+Ñ\3+	Ñof
&oa
%
1Ñ@8ÿÿÿÑ3:-ÿÿÿ/rb
pŒCrp(c
szoV
*06ŽiY
+Ñ“.
+Xoa
&o^
%
10	-Ø*03 r7pŒC(m

sn
r;pr7poo
oo
*03 sn

r7pŒC(m
r7pr;poo
oo
*0(!sp

sM(s(1Þ
,o1
Ü*
2(u(1*0"-sh*oEǃR6)8Â(Û(%*(Ý(&*(Þ(-*(Ül(/*(ß
(q
,sh*(1*o­sÒ+oÍ(1oçXo­2á*o­sº
o
+#	or
tBos
t
(1oÅo0
-Ô	*sh*6(5o*6(5o*>(5Po*0v#o

E4))))5«h8/osÐ*osÒ*osÑ*osÕ*o
sÏo+‘sÒo&XŽi2ç*sÏ
	ot+	oâ(5o&Xoà2Ù	*sÏotoÍ+Do2
¥	,(6
(5	+(6
(6		,(4
	oÌo0
-³Þu<,o1
Ü*sÕ*QW0Í$oE+G_GGŠÔ8‹o
-*sÐ*o-*sÒ*o#3*sÑ*o
	(q
,*	sÕ*o~t
(u
,*þ&oV
sÕ*o~]
3*sÏo+‘sÒo&XŽi2à*sÏot	
+	
oâ(5o&
X

	oà2Ø*sÏotoÍ+0o2
¥	

(6
(6,
(4
oÌo0
-ÇÞu<,o1
Ü**v=³Jsv
sw
(:*2sw
(:*0(x

sv
sw
(:*0*%oy
&(Boy
&(?
Þ	&shÞ*	F(3
(<o5
*0C&sX

sz
o{
~Y
rAp~Y
o|
(=o}
o~
oV
*0Ž'oEEm•½å
5ƒ*~Y
rKp~Y
o|
o}
*~Y
rWp~Y
o|
oo
o}
*~Y
rgp~Y
o|
oo
o}
*~Y
rwp~Y
o|
oo
o}
*~Y
rp~Y
o|
oo
o}
*~Y
rp~Y
o|
oo
o}
*~Y
r™p~Y
o|
oo
o}
*~Y
r£p~Y
o|
oo
o}
*~Y
r«p~Y
o|
~Y
r¹p~Y
o€
rËpo
o
oo
o}
*t
~Y
rÙp~Y
o|
oÍ+Bo2
¥	~Y
ráp~Y
o|
(4
o
o}
(6
(=o0
-µÞu<,o1
Üo}
*t~Y
rép~Y
o|

+	oâ(=	X
	oà2æo}
*âO10›(~:%
(‚
~Y
€9€8(Csƒ

o„
o…
~7o†
&þDs‡
oˆ
(‰
oy
-øÞ&~9QÞ*~9~Y
(Š
,QÞ~9QÞ	(‹
Ü*Y
cS†’0°)(BoŒ
.rõpszo

%	9Fþ~ó:”s
%rKp(
%rWp(
%rgp(
%rwp(
%rp(
%r™p(
%rp(
%r«p(
%r£p(
%rÙp	(
%rép
(
þ€óþ~ó	
(‘
9‘
E2–ájÃ_PW8Yo’
,
oy
&sh*oy
&(Bsh85o’
,oy
&(%*oy
,:o“
o”
(q
-&rp(Š
-
r'p(Š
,(%8Ý(%8Ño’
,oy
&(&*oy
,!
o“
o”
(`
&	(&8’(&8†o’
,oy
&#(/*oy
,O#o“
o”
o•
r+p(Š
,
#øÿ+
(h
&(/8#(/8ýo’
,oy
&~t
(2*oy
,'~t
o“
o”
(\
&(28´~t
(28¤o’
,oy
&~<
(3*oy
,'~<
o“
o”
(d
&(38[~<
(38Ko’
,oy
&~Y
(1*oy
,o“
(18~Y
(18o’
,oy
&~]
(5*r¹po–
,2r¹po–
rËp(—
,r3pr¹po–
(g
szoy
,4o“
o”
(b
(5݌ropo˜
(g
sz~]
(5+fo’
,oy
&~Y
s:
(4*oy
,o“
s:
(4+*~Y
s:
(4+(@*(A*oy
&oŒ
3o
(—
,r§pr¿p(™
szoy
&*ÒíV0ô*oŒ
3o
rÙp(—
,rÃpsš
zs¹
o’
,	oy
&*oy
9ª(BoŒ
3o
rÙp(Š
,	oy
&+oŒ
3o
ráp(—
,rápszo“
oŒ
3o
ráp(—
,rÿpszoy
,(?oÃ8gÿÿÿrp(g
sz*0€+oŒ
3o
rép(—
,rapszsÑ
o’
,	oy
&*oy
,9(BoŒ
3o
rép(Š
,	oy
&+(?oç+Ç*Æ+oy
&oŒ
.ðoŒ

.æoŒ
.ÜoŒ
.Ò*0@,~7-8rƒp
(P
o5
s(
s›
€7þDs‡
(œ
€7*0]r&p~8o
ŒH~8ož
ŒHoŸ
( 

~9~Y
(Š
,€9*~9(¡
(™
€9*trueTRUEfalseFALSE0(P
ropo5
€2C%Ðô(¢
€3C%Ðõ(¢
€4C%Ðö(¢
€5C%Ð÷(¢
€6~Y
€9s£
€:*j{>-Ð
(¥
*{>*"}>*{?*"}?*{@*"}@*j{A-Ð
(¥
*{A*"}A*{B*"}B*{C*"}C*0¨s£
€Ks£
€Ms£
€Os£
€Qs£
€Sd€Ds¦
€Js§
€Ls¨
€Ns©
€Ps)€R(ª
€Es«
€Fs«
€Gs¬
€Hs¬
€I(m(n*0¿-~Jo­
,*þo®
(IrR&po¯
,(Ko°

+K	šo±
r„&p(—
-.o²
Ži3!šo³
ÐH(¥
3
o´
(GX	Ži2®~K%(‚
~Joµ
Þ&Þ
Þ(‹
Ü*£±a£¶0T.~No¶
,*þrŽ&po¯
,(Os·
(Qo°
+~šo±
r„&p(Š
,0o²
Ži3Sšo³
ÐB(¥
3?o´
(M+0þ};o´
}=(Po±
	o¸
XŽi?wÿÿÿo¹
	+I	šþ};}<oº
}=(Po±
o¸
	X		Ži2¯~O%
(‚
~No»
Þ&Þ
Þ
(‹
Ü*8Fa8K0Ð/~Po¼
,*s½

o°
+=šo±
r„&p(Š
-þ};}<o¾
XŽi2»o¹
+,š
þ	};}<o¾
XŽi2Ì~Q%	(‚
~Po¿
Þ&Þ
Þ	(‹
Ü*´Âa´Ç0³0~M%(‚
~LoÀ
-~LsÁ
oÂ
Þ(‹
Ü~LoÃ
oÄ
,~LoÃ
oÅ
*rÌ&p
	¢	oÆ

~M%(‚
~LoÃ
oÇ
Þ&~LoÃ
oÅ
ÞÞ(‹
Ü**(+|a|+§0X1oV&oI3*oI3oÈ
-rä&p(É
s\z*oI.)oI. oI.oI	.
oI
@îoJoÊ

oË
,oJ*~IoÌ
,2~IoÍ
oÎ
,~IoÍ
oÏ
oJo[*~HoÌ
,2~HoÍ
oÎ
,~HoÍ
oÏ
oJo[*oÐ
,
oJ(Ñ
*(j
	,	oJ¢oÒ
*r>'poJ( 
s\zoI@Ø(g~JoÓ
(H-(J-rž'p(É
s\z(H-(Ô
t(F+sÕ
oÖ
(koI.o
&+á(H,Ao
		(×

+t#
o

oØ

X

	2Ý8 8oI@(h~NoÙ
(Ô
oV&oI;ÝoJtB(PoÚ
9(PoÛ


{<,"
{;tb
{=(koÜ
+’
{;t_oÝ
,
{=(koÞ
8_ÿÿÿ
{=(k&8Lÿÿÿ(N-rÜ'p(ß
s\zt(L(ko
8ÿÿÿ*02oV&oI.
oI3*oc
oI
	YE
ÂÂjÂ1DW8½oJtBoª8§oJ¥fo¦8‘oJ¥Ho§+~oJ¥go©+koJ¥ho¥+Xo¨(l-	oI.=o
&+âo¨oV&oI.oJtB(lo
+Ô*J¥E(à
o:*J¥C(á
o<*^¥'~E(â
o<*6¥5o8*J¥i(ã
o:*J¥j(ä
o:*J¥k(å
o:*J¥l(æ
o=*6¥mo=*0º~FÐE(¥
~T-þ€sR€T~Toç
~FÐC(¥
~U-þsR€U~Uoç
~FÐ'(¥
~V-þ‚sR€V~Voç
~FÐ5(¥
~W-þƒsR€W~Woç
~FÐi(¥
~X-þ„sR€X~Xoç
~FÐj(¥
~Y-þ…sR€Y~Yoç
~FÐk(¥
~Z-þ†sR€Z~Zoç
~FÐl(¥
~[-þ‡sR€[~[oç
~FÐm(¥
~\-þˆsR€\~\oç
*F¥H(è
ŒE*F¥H(é
Œm*F¥H(ê
Œi*F¥H(ë
Œj*F¥H(ì
Œk*F¥H(í
Œl*F¥H(î
Œn*F¥H(ï
Œf*F¥f(ð
Œ5*F¥g(ñ
Œl*FtB(ò
ŒC*ZtB~E(ó
Œ'*0Ý3~]-þ‰sZ€]~]
~HÐH(¥
ÐE(¥
(o~^-þŠsZ€^~^
~HÐH(¥
Ðm(¥
(o~_-þ‹sZ€_~_
~HÐH(¥
Ði(¥
(o~`-þŒsZ€`~`
~HÐH(¥
Ðj(¥
(o~a-þsZ€a~a
~HÐH(¥
Ðk(¥
(o~b-þŽsZ€b~b
~HÐH(¥
Ðl(¥
(o~c-þsZ€c~c
~HÐH(¥
Ðn(¥
(o~d-þsZ€d~d
~HÐH(¥
Ðf(¥
(o~e-þ‘sZ€e~e
~HÐf(¥
Ð5(¥
(o~f-þ’sZ€f~f
~HÐg(¥
Ðl(¥
(o~g-þ“sZ€g~g
~HÐB(¥
ÐC(¥
(o~h-þ”sZ€h~h
~HÐB(¥
Ð'(¥
(o*’oÌ
-sô
oõ
oÍ
oö
*0I4~D1r6(poÊ
(É
s\z-o<*u,',o%to«oj
*to¬*uB,
tBo<*uf,
¥fo9*uH,
¥Ho:*uh,
¥ho7*ug,
¥go;*u#,Oo?t#o÷

+
o2

X(p
o0
-äÞ
u<,o1
Üo>*u,Oo?to
+o2
X(po0
-äÞu<

,
o1
Üo>*u,loAto
+0o2
¥%(ø
tBoB(ù
X(po0
-ÇÞu<,o1
Üo@*oÊ

~G	oú
,~G	oû
oS*~F	oú
,~F	oû
oS*u,L	(ü
Ðg(¥
.Ðl(¥
.Ðm(¥
3
¥mo=*¥Ho:*	(i~P	oý
oAoþ
+~oÿ
{<,0{;o±
oB{;tbo
X(p+<{;t_		o
,%{;o±
oB	o
X(po0
:vÿÿÿÞ,o1
Üo@*4Ü ü3 SŠ=ǨŽ6095~S%(‚
~Ro6~R(p~RoV

Þ(‹
Ü*$0*(p*sÏ*¦~i-þ•sb€i~i(yt
*sÏ*006sM
~j-þ–sb€j~j(yt
*sÏ*¦~k-þ—sb€k~k(zt
*ZÐ!(¥
(k¥!*06sM
Ð!(¥
(k¥!*06sL
Ð!(¥
(k¥!*"(l*06sL
(l*(£
*N{
¥#o
*007s
}
þ
sR
~GÐ!(¥
oç
*(£
*^{
¥#o	
Œ(*0:8s

}
þ
sZ
~IÐ!(¥
Ð*(¥
(o*.~Go

*.~Io
*(£
*2(ýo
**{tþ**{tþ**{tþ**{tþ**{tþ**{tþ**{tþ*(­*2(ýo
*2(ýo
*2(þo
*2(þo
*0J9(þ&s

{uo
+o
(
o
o0
-äÞ
,o1
Üt* 9
0J:(þ&s

{uo
+o
(
o
o0
-äÞ
,o1
Üt* 9
(®*(¯*(°*(±*(²*(³*(´*2(ÿo
*2(ÿo	
*6(þo

*0);uB-rÃ(ps
z(
tB(Ì*0<(þ&{uo

(
*0L=(þ&(
{uo
{q(
o
(
(
{uo
*6(ÿo
*0;(ÿ&(
(Î*R(þ&{qo
*0‚>(þ&(
{qo
,C+/{uo
(
(Š
,{uo
+ X{uo
2Ã+{uo 
{qo
}s*02<(ý&{t3
{lo!
*{uo

(
*0c?(ý&{t3{lo"
+<{uo

(
(
{uo
{q(
o
}s*(£
*V(£
}t}m*V(£
}t}n*V(£
}t}o*V(£
}t}p*0(£
uh,}t¥h}m*uf,}t¥f}n*uH,}t¥H}o*ug,}t¥g}p*uB,}ttB}r*rù(ps
zV(£
}t}r*sÐ*sÑ*sÒ*sÓ*sÕ*n{t.rU)ps#
z{m*n{t.rU)ps#
z{n*n{t.r«)ps#
z{o*n{t.r«)ps#
z{p*n{t.rý)ps#
z{r*:(ýo
*07@(
(þo
tB(
{uo 
}s*z(þo
{uo$
}s*6(þo
*o
*0YA(þo

+3{uo
(
tB(Š
,{uo%
+X
{uo
2¿}s*2(ýo
*n{t.rS*ps&
z{m*n{t.r¥*ps&
z{n*n{t.rõ*ps&
z{o*n{t.rA+ps&
z{p*n{t.r+ps&
z{r*Z}t}m}s*Z}t}n}s*Z}t}o}s*Z}t}p}s*Z}t}r}s*(*"(*"(*N(ÿo
}s*6(ÿo
*6(ÿo
*V(ÿo
}s*R(ÿo
}s*R(ÿo
}s*b(þ&{uo
s*0.BtB
((Ì(
{uo'
*04<(þ&{q{uo

(
o(
&{uo%
*Ö{t3{lt*{t3{qt*rÝ+ps&
z0Q{t3{qt*{t,rA,ps&
z}ts)
}qs*
}u{qt*0F{t3{lt*{t,r“,ps&
z}ts
}l{lt*n-*u
,t
*sÔ*0%Což,
o¤o<*o™,
oŸo7*oš,
o o9*o›,
o¡o:*oœ,
o£o;*o˜,Do?o
+o2

t
(o0
-åÞu<
	,	o1
Üo>*o,goAo
+1o2
¥%(ø
tBoB(ù
t
(o0
-ÆÞu<,o1
Üo@*~Ë>	0;(
}s(ÿo
*z(³,o
*(®,o
*0ÉD-*{t{t.*{t
E+=Oas8€*{q{qo+
*{l{lo+
*{r{ro,
*|o{o(-
*|p{p(.
*|n{n(/
*|m{m(0
**{t*0•D{t3*
E['09CT+Ys)
}qs*
}u+As
}l+4}r++}o+"j}p+#}n+}m}t*0=E{s,{s*sX

s+o'(oV
}s{s*0Fo&
o'(o'*0vD{t
YE8> ,+CrÙ,p*|m(1
*|n(2
*|o(3
*|p(4
*r÷,p*{r*r-p*2(Œ%*0 <{vo

(
(
s5
*0<{vo

(
*0<{vo

(
*:(£
}v*2{vo0
*2{vo6
*"(7
*
*
*
*
*j*j**#*~Y
*~t
*~<
*
*~]
*~8
*~9
*~:
*~;
*~<
*~=
*rKp*sj*ss*ss*ss*ss*ss*ss*s¯*s°*s±*s~*"ls~*s‰*s—*sž*s¨*s®*0,+sÑ
{>
(0oç{?
(0oç*0>+sÑ
{@
(0oç{A
(0oç{B
(0oç*0>+sÑ
{C
(/oç{D
(/oç{E
(/oç*0P+sÑ
{F
(0oç{G
(0oç{H
(0oç{I
(0oç*0P+sÑ
{J
(0oç{K
(0oç{L
(0oç{M
(0oç*0P+sÑ
{N
(0oç{O
(0oç{P
(0oç{Q
(0oç*0È-sh*uh,¥hsj*uH,¥Hss*ul,¥ls¯*uj,¥jss*uk,¥kss*ui,¥iss*uE,¥Ess*uf,¥fs~*un,
¥nls~*uB,tBs‰*u&,¥&s—*u',¥'sž*u(,t(s¨*u:,t:s®*ug,¥gs°*um,¥ms±*u),¥)(6*u*,¥*(7*u+,¥+(8*u,,¥,(9*u-,¥-(:*u.,¥.(;*sh*0æGÐm(¥
3)o3o
(R
Œm*ojŒm*Ðl(¥
3(o3o(S
Œl*oŒl*Ðk(¥
3
oьk*ÐE(¥
3
oҌE*Ðj(¥
3
ohŒj*ÐB(¥
3o*Ðh(¥
3oŒh*Ðn(¥
3
okŒn*Ðf(¥
3oŒf*ÐH(¥
3oŒH*Ð&(¥
3oŒ&*Ð*(¥
3&o
3toŒ**~9
Œ**Ð,(¥
3&o
3to!Œ,*~;
Œ,*Ð-(¥
3&o
3to"Œ-*~<
Œ-**sj*ss*ss*ss*ss*ss*ss*s°*s±*s~*"ls~*s‰*s—*sž*s¨*s®*(6*(7*(8*(9*(:*(;*o*o*o*o*o*o*"ok*o*o*o*o*o*o*o*o *o!*o"*o#*0ŒHoÊ

o¹
Žisº
+i	šÐr(¥
(T
-Mo
(<o-&oº
ÐB(¥
.oº
Ð:(¥
3o±
oÅ	X
	Ži2‘*0YIPoÊ

o¹
+?š
	Ðr(¥
(T
-%	o±
oÈ,	P	oº
(=oÜ
XŽi2»*(£
*
*:(h}‡*{‡*2{‡-**r{‡-
#*#ð?*R{‡-rE-p*r'p*R{‡-~‰*~ˆ*o*0%GE
1œ€ˆE0œ€‰*
*:(h}Š*6{Šþþ*{Š*{Š*"{Šj*"{Šj*"{Šl*2|Š(3
*2{Š(U
*o*
*:(h}‹*’{‹(V
-{‹#þþ**0J{‹(V
,*{‹#ÀÿÿÿßA6 ÿÿÿ*{‹#àÁ4 €*{‹(W
i*0B{‹(V
,*{‹#àÿÿÿïA6*{‹#4*{‹(W
m*0S{‹(V
,j*{‹#àC6
!ÿÿÿÿÿÿÿ*{‹#àÃ4
!€*{‹(W
j*0I{‹(V
,j*{‹#ðC6 ÿÿÿj*{‹#4j*{‹(W
n*{‹*Z|‹rI-p~X
(Y
*2{‹(Z
*o*
*v(h,}Œ*~Y
}Œ*ò{Œ(q
,*{ŒrE-p(Š
-{Œo•
rM-p(Š
,**0J{Œ([
,(\
i**0J{Œ([
,(\
m**0J{Œ([
,(\
j*j*0J{Œ([
,(\
n*j*0J{Œ([
,*#*{Œ*F(3
{Œo5
*0K{Œ(\
,*~t
*0L{Œ(d
,*~<
*0M{Œ(]
,**o*
*:(h}*Z{~t
(u
-**J|þ&oV
*{*2|(^
*o*
*:(h}Ž*01N|Ž(_
1rY-p
+r‰-p
|Ž(`
(a
*2{Ž(b
*2{Ž(b
*6{Ž(b
n*6{Ž(b
n*0	.O|Ž(`
 ²sc
(d

(e
(f
*{Ž*o*
*:(h}*æ{(g
,%{oh
,{oi
*{oV
*~Y
*{*F(3
oo5
*o*
*v(h,}*~]
}*0I(hE
d ^Ҝd ^Ҝd ^Ҝ ^Ҝ}*0‰(hE
8c j]Ҝ0c j]Ҝ(c j]Ҝ c j]Ҝc j]Ҝc j]Ҝc j]Ҝ j]Ҝ}*0‰(hE
8d j^Ҝ0d j^Ҝ(d j^Ҝ d j^Ҝd j^Ҝd j^Ҝd j^Ҝ j^Ҝ}*2{(j
*{*²{‘b{‘bX{‘bX{‘X*0d{‘n8b{‘n0bX{‘n(bX{‘n bX{‘nbX{‘nbX{‘nbX{‘nX*0d{‘n8b{‘n0bX{‘n(bX{‘n bX{‘nbX{‘nbX{‘nbX{‘nX*6{(k
*	*J(hsl
}‘*N(hsm
}‘*v(h,}‘*sl
}‘*>{‘on
þ*"(3*2{‘on
*
*2{‘oo
*2{‘op
*0{‘oq
,*sh*:{‘or
*6{‘os
*:{‘ot
*j{‘(4
(6
ot
*6{‘ou
*:{‘oq
*2{‘ov
*N{‘(4
os
*sw
zN{‘(4
ou
*F{‘ox
Œ<*
*F{‘ox
Œ<*
*J(hsy
}’*N(hsz
}’*v(h,}’*sy
}’*0>P{’o{
E
+{’o|
oҜX{’o{
2Ù*0Qos®
o*0Qos®
o*0Qos®
o*09R~8

(à3((âok}>
(âok}?
*0MS~9

(à3<(âok}@
(âok}A
(âok}B
*0JT~:

(à39(âo}C
(âo}D
(âo}E
*0aU~;

(à3P(âok}F
(âok}G
(âok}H
(âok}I
*0aV~<

(à3P(âok}J
(âok}K
(âok}L
(âok}M
*0aW~=

(à3P(âok}N
(âok}O
(âok}P
(âok}Q
*>{’o{
þ*"(3*2{’o{
*
*6{’o|
*:{’o}
*6{’o~
*:{’o
*6{’o€
*6{’o
*2{’o‚
*6{’oƒ
*0G

+3{’o|
o3{’o|
o(Š
,*X
{’o{
2¿*sw
z6{’o„
*F{’o…
Œ>*F{’o…
Œ>*(£
*{­*"}­*{®*"}®*{¯*{·*{¶*(ú*0X(£
}­}®}± €s†
}µ}´}¯}³sï}°{°}©*0]

AYE#&),/2aYE+
***
***0Y*0ÝX 
þüs¢þýs¢þþs¢þÿs¢þs¢þs¢þs¢þs¢þs¢	þs¢
þs¢þs¢þs¢
þ	s¢þ
s¢þs¢þs¢þ
s¢þs¢þs¢þs¢þs¢þs¢þs¢þs¢þs¢þs¢þs¢€¬H%Ðø(¢
€«*0i

\0'0".@'.;+N/.4\./+Bf0b.3f.0+1n.rYE+(‡
*
*	*
***?*0
8í{©{² ;Û{©{²	2{©{²
>º{©{²125{©{²90&{©{µ{©{²Ñof
&}¨*{©{²
:0A'0";…';8I,YEl|,¢:.g8"f0"[YEHHf;œ8ûn;™t;›{YEÖ8Ñ}¨}§*}¨}§*{©{µ{©{²Ñof
&}¨*{©{µ{©{²Ñof
&}¨*}¨*}¨*	}¨*{©{®-*{©"}²}¨}§*{©{­-*}¨**{©o:þÿÿ*0‰
{©o&{©{²125{©{²90&{©{µ{©{²Ñof
&}¨*{©{²
03&{©{µ{©{²Ñof
&}¨**09
8"{©{²021{©{²90"{©{µ{©{²Ñof
&8â{©{² .{©{²	2{©{²
0}§}¨*{©{²
E0,YE}1E.R+v].
e.F}3g{©o}§}¨*{©{µ{©{²Ñof
&}¨*{©{µ{©{²Ñof
&}¨**{©o:Îþÿÿ*0î
{©o&{©{² .{©{²	2{©{²
0}§}¨*{©{²
E0,YE}1E.R+v].
e.F}3g{©o}§}¨*{©{µ{©{²Ñof
&}¨*{©{µ{©{²Ñof
&}¨**0R{©o&{©{²025{©{²90&{©{µ{©{²Ñof
&}¨**0
8ì{©{²021{©{²90"{©{µ{©{²Ñof
&8¬{©{² .{©{²	2{©{²
0}§}¨*{©{²
E0,.E.,+P].
e. }3A{©o}§}¨*{©{µ{©{²Ñof
&}¨**{©o:ÿÿÿ*0›
{©o&{©{²025{©{²90&{©{µ{©{²Ñof
&}¨*{©{²
+YE(+&{©{µ{©{²Ñof
&}¨**0É
8²{©{²02.{©{²90{©{µ{©{²Ñof
&+u{©{² .{©{²	2{©{²
0}§}¨*{©{²
,.
].}3{©o}§}¨**{©o:>ÿÿÿ*0)
{©o&{©{²
r3

}¨**0)
{©o&{©{²
u3
}¨**0/
{©o&{©{²
e3}§}¨**0)
{©o&{©{²
a3

}¨**0)
{©o&{©{²
l3
}¨**0)
{©o&{©{²
s3
}¨**0/
{©o&{©{²
e3}§}¨**0)
{©o&{©{²
u3
}¨**0)
{©o&{©{²
l3
}¨**0/
{©o&{©{²
l3}§}¨**0t
+c{©{²
".\.+.{©o}§}¨*}ª}¨*{©{µ{©{²Ñof
&{©o-*0/
{©o&{©{²
"3}§}¨**0¦
{©o&{©{²
\0'0".N'.I+v/.B\.=+jf0b.1f.,+Yn.%rYE;+9}¨*{©{µ{©{²(ûof
&{ª}¨**0ç

 {©}¸8¼{©{²02{©{²91<{©{²A2{©{²F1{©{²a2o{©{²f0`{©%{¸{©{²(ùZX}¸X
[31{©{µ{©{¸(‡
of
&{ª}¨**{©o:4ÿÿÿ*0t
+c{©{²
'.\.+.{©o}§}¨*}ª}¨*{©{µ{©{²Ñof
&{©o-*0<
{©o&{©{²
'3{©"}²}§}¨**0:
{©o&{©{²
*./.+}¨*}¨**¦+{©{²
3	}¨*{©o-Û*ª+{©{²*3
}¨*{©o-Ú*0B+1{©{²*."{©{²/3	}¨*}¨*{©o-Â*0
(%
}².*}¯*0$
{±,{±
}±*{³oa
*0ËY{°}§~¬{´Yš
{°o-{²sZz{¯,*{°{§,i{µoV
}¶{µ{µoˆ
o‰
&~«{´Y”}·{· 3{²}·{°{¨}´*{°{¨}´8Aÿÿÿ6{²}±*(£
*{Ê*v{É{Ê[Z}É}Ê*{Ì*"}Ì*{Î*{Í*"}Í*.(Š
€Ä*¦(£
se
}Ë{Ës‹
}Î(-*6s‹
(+*Š(£
-r³-psŒ
z}Î(-*0Z{Å{Â-{Å%{¿X}¿{Í-*{Ç,rÁ-ps\z
EDiŽ*{Å{À:¯r!.ps\z{Å{Á,{Å{Â9‡rU.ps\z{Å{Á,o{Å{Â-br‹.ps\z{Å{Á,
{Å{Â,=r³.ps\z{Å{À-%{Å{Á,
{Å{Â-rç.ps\z*0W}ǍC}È}É}Ê}Ì}Ís
}Æs }Å{Æ{ÅoŽ
*05
+,]

/Y0Xѝ+
YA
YXѝcX2Ð*r{Ì,%{É{ÊX}É*0@
{Ì,+{Å{Â-
+{Î oi
X
{É2æ{Îoj
*"(2*0N,({Å{Â-{Å{¿1
{Î,oi
{Ì,{Å{Â-
{Î
oi
*0Z[~Y
(0{Î"oi
oA

8oC
YE„9–r$".I\.D8‡{Îr/poj
8Ï{Îr/poj
8º{Îr!/poj
8¥{Î\oi
{ÎoC
oi
8{Îr'/poj
+o{Îr-/poj
+]oC
 2oC
~0{ÎoC
oi
+3oC
{È(.{Îr3/poj
{Î{Èo
X?Úþÿÿ{Î"oi
*r{Ì,%{É{ÊY}É*j{Ë-~Y
*{ËoV
*0O}Ç{Æo
s }Å{Æ{ÅoŽ
{Ë,{Ë{Ëoˆ
o‰
&*¾(,(1-rM-p+rp(0{Å}Â*®(,(1~Ä(‘
(0{Å}Â*0S(,(1~Ä(’

(0.o“
3Eo“
3{Îr9/poj
{Å}Â*®(,(1~Ä(”
(0{Å}Â*®(,(1~Ä(•
(0{Å}Â*Æ(,(1-
r?/p(0+(3{Å}Â*®(,(1~Ä(–
(0{Å}Â*0`(,(2{Æo—
&{Æo˜
3	}Ç+{Æo™
}Å{Å}Â(4rI/p(0*0G(,(1rM/p(0s }Å{Å}À{Æ{ÅoŽ
(/*0`(,(2{Æo—
&{Æo˜
3	}Ç+{Æo™
}Å{Å}Â(4rQ/p(0*0G(,(1rU/p(0s }Å{Å}Á{Æ{ÅoŽ
(/*0–
(,(1(3{Ì,`oA
{Å{Ã1{ÅoA
}Ã{Å{ÃoA
Y
+{Î oi
Y
/ë{ÎrY/poj
+
{Î:oi
{Å}Â*2{âoð*6{âoñ*2{âoò*6{âoó*{á*{à*{é*{è*(O*:sT
(N*&(N*0}(£
-r_/psŒ
z}ã}ä}åsš
}Ý{Ý o›
{Ý o›
sø}â}á}à}æ}ç*0r\sœ
€Ü (Q [H
[ž 
ž(P 
(Q 
"H ž ž]ž(P 
[H ž ž]ž(P 
]H
	]ž	(P 
{H ž ž]ž(P 
 H ž ž]ž(P 
 H ž ž]ž(P 
 H ž ž]ž(P 
 H ž ž]ž(P (Q {H		{ž	 	ž	(P 	(Q 	"H


ž
 ž
}ž
(P 	}H}ž(P
(Q
"H ž:ž ž(P (Q ,H

,ž

ž
 ž
(P }H ž(P (Q "H"ž ž"ž(P (Q [H ž(P {H ž(P (Q "H ž(P [H ž(P {H ž(P  H ž(P  H ž(P  H ž(P  H ž(P (Q ,H,ž ž ž(P ]H ž(P*N~Üo
ož
*F~ÜsŸ
o 
*0].o“
3eo“
3Eo“
.([
,}éŒf}è*(`
,}éŒH}è*(¡
,}éŒg}è*}éŒH}è*0f{ß[3}é}ä*{ß]3}é}ä*{ß{3}é}ä*{ß}3}é}ä*{ß"3/{ã,}ã}ä*{é-	}é}ã*{ß 3{âoö}è*{ß 3
}éŒh}è}ä*{ß 3}é}ä*{ß 3{âoö(R}ä*{ß
3}é*{ß 3
}éŒh}è}ä*ú{á,*{âo&{âoô,(U*{âoõ}Þ*Ê{á,*}á}à{ç,{æoU
}æ*0N^{á,*{à,2}à{Ýo¢
{Ý o›
{Ý o›
}ã}ä}é}è{å-}å(T-*{ä,{Ýo£
 3}à*{Ýo¤
}ß(S{ß{Þ31(T-°{Ýo£
 .rm/ps\z{ä,**~Ü{ßo
{Þo¥

Þ{ÞsYz” ;NÿÿÿŽiY+{Ý”o›
Y/ê8+ÿÿÿò|(¦
*^rÃ/pŒ(É
(§
*brÃ/pŒ(É
(¨
*br0pьC(É
(§
*fr0pьC(É
(¨
*"(§
*&(¨
*BSJBv2.0.50727l,N#~˜NÐ;#StringshŠ\0#USĺ#GUIDÔº#BlobWߢ+	ú3},úaЩk:^Pd7D


"
VC
{\ŽCšC¦C²
¿CÕCá
æ
ðð'ð6ðDðL
XNsN	N@	NðÞúÓhÓúÞ?
-
W
a
n
¤
?-
tN
`ðŠC	…š

ª
½…Ï…á…õ………7 ð!ð~"r"ù$ä$
 %ð%NR&
ý(Þ(c*
¨*Œ*Ä*Œ*ó*Ó*+Ó*O+
c+r"
‡+
+…©+
Ù+N
ƒ!
,
),
.,

N,C,Ë,
Ñ,
-NS-Ó]-Ów-Óæ-Õ-ô-Ó.Ó(.ÞA.Þ.ÓŒ.Óø.Ó*y/
‰/
È/
ô/Ó*0
0Þ(•0Þ( 0
Ä0ä$ö0-
1-
^1
p1-
Ì1-
×1
ð1C'
2
í
‚4
ˆ4
Ž4
•4
¥4
8
h9-
9
”9
ç9
þ9
&:
1:ä$:
¿;¿$;¿4;Ã4;q;
;ðµ;¥;+5Rc	;Fkc	>Fyc	ALˆc
DR•c
DV¤c
DZ±c
D^Àc
DbÏcDf¡Úcl˜çcl­ðcv
51w51ƒ55‡+5‡/5H‡i:5HŠrE5H‹}M5HŒˆW5H–_5HŽg5H§n5H­x5H‘¸5H’Јc1“ï”c§ïŸc«ð¥
¹²c1¹ ¼c¿ ÊcÄ!Õc1ÏCßcÜCêcMêWøc1ê^³.ó^:0	ù^9ù^:9ú`?;	ûbQ€aFQ€sFQ€FQ€ŒXQ€›XQ€«Q€¼Q€ÌQ€ÝQ€ñQ€Q€Q€&Q€9Q€IQ€ZQ€qQ€†Q€›Q€®Q€¾XQ€ÑXQ€áXQ€õXQ€
XQ€øQ€(øQ€=øQ€RøQ€iøQ€øQ€•øQ€­øQ€ÃøQ€ÖøQ€éøQ€þøQ€øQ€%øQ€8øQ€QøQ€høQ€øQ€”øQ€«øQ€ÀøQ€ØøQ€îøQ€	ø1$C1›¿1´¿1Ï¿1é¿ðNúRXVJ
O
“W
–\
–i
“r
“\
–ã
“ñ
·’F´UÄZÙZðddt1+VJ~1SVa1qV†™1–V«§1¹VA2(„2(Ç2(
3(M3(3(Ó3(4(Z4(É4b5bS5b˜5bÝ5b"6bg6b¬6bñ6b67b{7bÀ7bt8	¬8	ä8	²‰½“Ê‘ÖFß”é—õXX ¥n†ÝFV€å°V€í°V€õ°V€ý°V€°V€	°V€°V€°V€°V€°V€°ÝFV€"áV€&áV€á “  C+ C F ‘ X J V b C ~ ÝFV€_!]V€d!]V€k!]V€p!]V€v!]V€{!]V€ƒ!]V€ˆ!]V€]V€!]V€™!]V€ž!]V€]V€§!]V€×]V€²!]V€]V€¼!]V€À!]È!“Ï!FÙ!ÀÛ!Fæ!Ä÷!È	"“"“4"“A"ÎM"FZ"Fe"Òl"FŒ"ך"X§"F­"FÝFV€¦$
	V€®$
	V€·$
	Vۀ$
	V€×
	¬F¦$“®$“Í$“Ü$F
%	%	(%	2%“B%¿J%FV%Fc%×w%“„%“˜%&	ÝFV€_!Z	V€Ë&Z	V€×&Z	V€ä&Z	V€î&Z	V€ù&Z	V€'Z	V€'Z	V€'Z	V€Z	V€íZ	V€v!Z	'd	'r	.'F<'FK'“4"“W'À]'“n'“|'“e"Ò‰'“™'V§"Z	ÝFV€_! V€ V€ V€ V€' V€' V€' V€í /Ûà/”&0”W0O
k0O
];n’)q)DP –8Gr –8N² –_U¼ –_\ß –€dè –€k !‘šs	”"‘µ{#‘΃
Ä#‘åNè%‘üN8&‘NÀ&–$‹ü&–3‘('–<˜¨'–GŸÔ'–T§ø'–e­4(–y³P(–GÐ(–¹4)–NÈ)–	¹ì)–	à *–*	Ê!(*–M	Ð"D*–i	Ê#h*–ˆ	Ð$Œ*‘­	Ã%Ü.‘Ì	Ã&d/‘ë	Ã'0‘
Ã(t0‘$
Ã)(1‘?
×* 2‘\
ß,ì2‘w
ç. 3‘
ï0,5‘¶
ø3Ì5‘Ú
6È6–ü

97–
: 7–(
;œ7–<<°8–Q>ô8–g A49–y Ct9–‰NE¸9–‰¹FÈ9–‰&GÙ:–™ÊHç:–™-Iõ:–™4K;–­?Nœ<‘»GPˆ>–(GQ›>–(NR¨>–(¹SÐ>–(YT?–;UU,?–QÊV|?–v`W(B–ŽhYìB‘¡Y[¸G‘µp\¸H‘Åw]DI‘×~^xI‘æ„_ÄI‘
ˆ_\J‘Ì„aéJ†z
šaK†Š
Ÿa
K†š
¥bK†¦
©bK†²
¥c&K†½
©c/K†z
šdJK†Š
ŸdSK†ü
¥e[K†
©edK†ÀflK†-Êf†TßgÆZåiÆ|íkƈùo†TßpÆZÿrÆ|tƈùx†TßyÆZ{Æ||ƈ#†T߀ÆZ)‚Æ|0ƒÆˆ:††T߇ÆZA‰Æ|F‰ÆˆN‹xK‘Ì„Œ,L‘Ó¬ŒM‘䬍N‘ö¬ŽˆO‘²pP‘¼‘ÔS‘Å“¤U‘„•HX‘2„•1[‘HÏ•X[‘Yç™ä^–dñ<_–döžN_–kþ €_–k¡Ã_–k¢í_–k£`–k¤0`–k&¥Y`–Ŧd`–-¨œ`–‰5ªø`–H@«>a–š„¬Ja–®„¬Va†TM¬þT‘%2ö¬U‘h2ö®$U‘«2ö°<U‘î2ö²JU‘13ö´]U‘t3ö¶pU‘·3ö¸ƒU‘ú3öº–U‘>4ö¼jW‘¬4]¾|W‘ñ4]¿ŽW‘65]À W‘{5]Á²W‘À5]ÂÄW‘6]ÃÖW‘J6]ÄèW‘6]ÅúW‘Ô6]ÆX‘7]ÇX‘^7]È0X‘£7]ÉG_‘d8Êx_‘œ8ʼ_‘Ô8ÊÆ
š
¥ÊÆ
Â¥ÊÆ
Ð¥ÊÆ
Ý¥ÊÆ
ç¥ÊÆ
ò¥ÊÆ
ÿ¥ÊÆ¥ÊÆQÊÆ!UÊÆ(YÊÆ4_ÊÆ<cÊÆF©ÊÆQgËÆ[lÌÆbqÍÆnxÎÆv}ÏÆdcÐÆd‚Ð^a†UÑka†š
¥Ñva†Â¥сa†Ð¥ьa†Ý¥їa†ç¥Ñ¢a†ò¥Ñ­a†ÿ¥Ѹaá	!UÑÀaá	J¥ÑÍaá	²ÑÚaá	È¥Ñçaá	¥Ñôaá	D¶Ñ\bá	u¶ÑÄbá	ª¥ÑÌbá	Ë¥ÑÔbá	î¥ÑÜbá	¥Ñäbá	/¥Ñìbá	O¥Ñôbá	q¥Ñübá	“¥Ñ	cá	¼¥Ñcá	äÑ$cá	»Ò\cá	FÁԄcá	ÆÕÜcá	¼Á×ìcá	ÞÆØd†ÌÚ(d†=ÒÛ¸d†ÙÝød†=ßÞge†TMàoe†T©à…e†Tgá›e†Tlâ±e†TxãÈe†Tæäqf†T}å‡f–ëæf–ñç—f–÷èŸf–ýé§f–ê¯f–ëËf–	ìçf–íg–îg–ï;gá!ðLgáK»ògárMô®gá)ô¼gáÎ.õÄgá	æõ)há63ö6hác¥öRháƒQönhá¢UöŠhá¾_ö¦háÛcöÂháú©öÙhág÷ðhá9løiáUxùiár}ú5iá‘cû=iá‘‚ûFiá­8üOiáÊMýciáé)ýqiá8þiá4Æÿ•iá[æªiá{l¿iá¦.Øiáæ=jálTjZ¶ŒjkDìj|I>k‡N\k‘’T¬l†n8
Ôl†—Môlæœ]Émæ(YÔmæbqxn†dc
Än†d‚
ðnÆ£croæ	~²€oæ	š”¬oæ	¤²Ìoæ	¬²ìo†Tšûo涥pæ¿Mp†T}pÆ	+å!pÆ4¥$pÆ>U'pÆHê*pÆS_.pÆZî2pÆbQ=pÆicDpÆ“òKpÆ£øRpÆ®þUpÆ´\pÆÅ	cpÆ×jpÆêqpÆýxpÆ!pÆ&'†pÆ£cp–/-•p–;3p–;9¥p–;?­p–;Eµp–;K½p–;QÅp–G9Íp–TWÕp–]]Ýp–gcåp–giîp–p¹öp–{oþp–„wq–q–•G q– ‡!Pq–¬"œq–¸—#èq–ÅŸ$Dr–ѧ% r–à¯&ür–ë·'Ðt–k½(Âv–-*Êv–3+Òv–9,Úv–?-âv–E.êv–K/òv–Q0úv–W1w–]2
w–c3w–i4w–¹5#w–o6+w–w73w–8;w–G9Cw–‡:Kw–;Sw–—<[w–Ÿ=cw–§>kw–¯?sw–Å@{w–ËAƒw–ÑB‹w–×C“w–ÝD›w–ãE£w–éF¬w–ÊG´w–ïH¼w–÷IÄw–ÿJÌw–UKÔw–LÜw–Mäw–Nìw–Oôw–'Püw–/Qx–ö7Rœx– =Sy†TMU	yÆ+åUy†T©UyÆ4¥V#yÆ>UV0yÆbQVMyÆicVbyÆ´VwyÆ£cV€y‘Ì„V±yÆ+åV´y†TlVÃyÆ4¥WÑyÆ>UWÙyÆHêWáyÆS_WêyÆZîWóyÆbQWüyÆicW	zÆ´WzÆ£cWzÆ+åW!z†TgW0zÆ4¥XXzÆ>UX°zÆHêX{ÆS_X`{ÆZîXµ{ÆbQX½{ÆicXÔ{Æ´Xá{Æ£cXé{Æ+åXì{†T}X
|Æ4¥YH|Æ>UYp|ÆHêY˜|ÆS_YÀ|ÆZîYè|ÆbQY}ÆicY}Æ´Y,}ƓòYP}Æ£øYt}Æ®þY”}Æ£cYœ}Æ+åYŸ}†TOY®}Æ4¥ZÅ}ÆicZØ}ƓòZà}Æ´Zí}Æ£cZõ}Æ+åZø}†T[Z~Æic[E~Æ>U[R~ÆHê[_~ÆS_[m~ÆZî[|~Æ´[¶~Æ£ø[¾~Æ£c[Æ~Æ+å[É~†Tg[Ø~Æic\Æ®þ\Æ´\,Æ£c\4Æ+å\7†Tn\X†Tt]°†Tx^H€†Ty_݀Æic`ê€Æ´`ò€ÆHê` ÆS_`ÆZî`‚Æ£c`‚Æ+å`‚†TM`%‚†Tl`9‚†TˆaW‚Æ4¥bg‚Æ£cbp‚æ	Ub}‚æ	5¥b€‚æ	l”b‚æ	Ÿœbœ‚æ	¥bÀ‚æ	=«cςæD ²e݂æn«fì‚æn·hƒæ/²iƒæP Âj$ƒæ—Ml1ƒæÅÊlEƒæDÕmLƒæ/Êo`ƒ†û.prƒá\ âpuƒá63p‡ƒÆ+åp‹ƒ†TMpžƒ†Tlp²ƒ†TqЃƴr„ÆS_r<„ÆZîr\„ÆHêr|„ÆÅ	rĄÆ×r …Æêrx…Æýrè…Æ!rX†Æ&'rņÆ4¥rՆƣcrކæ	Urë†æ	5¥rî†æ	&rü†æ	=,s‡æ,3u‡æT,v(‡ælx6‡æn9yD‡æ—MzQ‡æÅ?z`‡†Å²{³‡æDE|º‡æ/?~ȇá63ڇá!M쇆TMô‡†µ"¥ü‡†Ç"©ˆ†Ù"¥€
ˆ†ö"©€ˆ†#¥ˆ†"#U&ˆ†,#c.ˆ‘Ì„8ˆ†T܁œˆ‘<#ã‚x‰‘E#„ƒd‹‘W#èƒ܋‘f#í„썑m#í…„Ž‘t#í†̏‘{#í‡Ȑ‘‚#íˆ(‘‘‰#í‰8’‘#íŠà’‘—#틸“‘ž#íŒ𓑥#í(”‘­#íŽd”‘µ#폜”‘½#íԔ‘Å#í‘•‘Í#í’H•‘Õ#í“€•‘Ý#픸•‘å#í•ô•‘í#í–t–‘õ#í—°–‘ý#í˜d—‘$í™X˜‘
$íšؘ‘$í› ™‘$íœf™‘%$흐™‘-$íž¼™‘5$íŸš=$¥ 8šE$U hš†N$¥ ?›X$M †Tß ÆZ÷¢Æ|ý£Æˆ	¦M›†TM§U›†Ÿ%U§]›†¯%l§{›†¿%¥¨ƒ›†Ï%©¨Œ›†ß%+	©”›†î%¥©œ›†û%©©¥›‘Ì„ª±›†TMªۛ†T1	ª集T8	«œ&?	¬4&M­˜‘&F	­ٝ#&M¯ø*&}¯Dž.&M°Pž.&©°¬ž9&}± C&M²/ Æ£c²L †¿M²§ †L&©²× †L&M	³¡†L&g´c¡†L&lµ¡†L&x¶»¡†L&}·í¡†L&y¸¢†Z&M¹ˆ¢†h&M¹Ü¢†x&M¹H£†‡&M¹œ£†˜&}¹>¤†µ"¥ºK¤†Ç"©ºY¤†Ù"¥»f¤†ö"©»t¤†#¥¼|¤†¥'¥¼„¤†"#z	¼Œ¤†¬²¼”¤‘Ì„¼›¤†T}¼ª¤†Tܽ´¤T€	¾@¥‘³'„À¾©‘Æ'ˆ	ÀÒ©‘Ò'‘	Ã䩁Þ'}Ä€ªì'MÅò«ú'¥Å1¬†(MÅd¬†
(¥ÅЭ†TMÅØ­ƒT	Åð­ƒT£	Æ	®ƒTlÈ"®ƒT«	É<®†T}ËE®†T²	Ì`†TM·`†"9åÎØ`†TMÐà`†P9Ð($(+(+(/(=(=(/($(+($(B($(K($($($($($(R($(R($(Y(f(f(s(=(=($(~(e"+(+(+(+(e"e"e"e"e"˜%+(˜%B(˜%K(˜%‹(+(˜%’(B(˜%’(K(e"e"e"e"™(e"£(ª(±(³(±(³(+(+(µ(+(µ(˜%+(µ(+(Æ(Î(Æ(Æ(=(=(˜%=(Æ(Ø(e"e"e"e"
))      ))$)˜%$)˜%())1)))$)˜%$)˜%())1)))8)8)())1)))8)8)())1)))())1)>)A)D)e"N)e"V)\)f)q)$)˜%z)Œ)$)$)˜%e"e"e"e"N)e"N)’)q)$)˜%$)˜%$)˜%$)˜%$)˜%$)˜%$)˜%$)˜%$)˜%8)8)8)8)8)8)8)8)8)8)8)8)›)›)›)›)›)˜%Ÿ)Ÿ) £)£) §)§) ­)­) §)§) ·)¿)¿)¿)$)Æ)=(=(=(=(=(=(=(=(=(=(Ê)§)Ÿ) Ÿ)Ÿ)›)›)›)›)›)˜%   §)  §)£)Ÿ) £)$)$)˜% Ð)˜%Ò)Ý)                                                                 $)$)å)           ð) Ÿ)Ÿ) Ÿ)Ÿ)ù)þ)Ÿ)Ÿ)ù)þ)Ê)§)þ)ð) §)§) ù)§)ù)§)ù)ù)*Ê)§)ù)  e"
******************************))**())1)   *˜% *%*'*Æ)+*Æ)·)¿)¿)¿)¿)Æ)¿)5*  C*e"e"M*S*W*[*w*¿)§"§"|*³(³(|*Ý)Ý)|*$)˜%8)!
0




!
)-
!!9U9|¥9»²1÷¥15¥1l¶1Ÿ¶!÷¥!5¥11=»)Á)=Æ!Á!=Æ9D!1n»1—M1Å)1û.1/æAû3!n8!—M!Å)!,8!TÆ!/æ!l)û.)T=)l$ûñ<ûñ±TM¹TMÁT¹	ÑTlÙTM©Tn¡(M¡1+¥©=+©Tl¡L&Î	¡E+Û	D~ù	Y¶¥á[+MY~²él+
L¤ù	éu+
L¬
¡~+U1T:
é<A
ATG
ù•+O
ù£+V9¶+V
9Â+b
9Í+ø¡ä+Ž
é+U¡ô+_,š
£cœŸ
¡,x¡
(±
1;,¾
9X,ã1k,Ê
9X,Ñ
1u+Ö
1s,O
9|,ã1u+³é,
é<ê
™,Ÿ
™,²±T}(M	£c¡(M¹TM¤,X
(T1ª,!ù³,C¾,UÃ,*Aª,/
(UIÙ,6ê,<9ª,C‰TM‰ñ,mê,tùø,‚¡L& ¡L&}¡-M¡- ê,ÐTÖ-ÜQTè&-ùQ¤²Q¬²14-J19--©T_ÉTèùE-6Y
(¥ÑT8	Ñh-mi-ti“-Mi(Mi£-}i¯-tiÃ-Mqî-˜yTMy.y5.¤‰nª‘TßyX.±Ys.¸9-Äqz.˜Y˜.ÕY¥.c©TMTTlTnìTP ôY'/¥Y:/cE/cJ/cYR/ý_/Äim/cê,
¹T}ÁTMÁ
()
É¡/UÉ°/UÙm/cÁ/9
ÁÔ/A
É0E
	TMÙTT
é²0[
\TMdTMlTMtTMñ×0–
|TM„TMŒD ¿
éš
¥éé0Å
é1Ë
á1cù(1Ò
;1šùM1šŒnì”D ¿
œTM¤nìéz1„1š”nì¬D ¿
´TM¼nF¬nìÄD ¿
ÌTMÄnìÄ)ÔD ¿
Ô)é’1Ônìéœ1¥Á/§	¨1šé°1­ÜD ¿
Ü)äD ¿
ä)éÁ1¥akËZÒŒ)!á1Ù)TMéú1šá1ß	2è”)¤D ¿
¤)	2»ù2¥ù	2îÁ/öI;,,I£1I£6I;,@I;,EI;,JIœ4Oì=ìIè7fIœ4kIï7pI÷7uIÿ7zI8I8„Is,‰I!8ŽI8•I+8šI28ŸôTMÜnìä=ìû3)¤²)¬²ìD ¿
ì)a=8¸¬)üûñ~ù	O8ùX8¥ùO8Ò’)$Zÿ,TM,’),"9å4q)D<Z)LTMLq)DLP9\—Md—MyT}lTMtûñ|~ù	„¤ù	ŒnF”TM„¬
œnF	T}¤.¬=ì„Tì¤=F¬)¬D ¿
´U´nF¼.¼=FT}´—M¤l‰T}¤TF¬/¿
ÄTMÌTM	œ)œ²Aœá9œæ1œëAœðA£c1£cA£c9£c)T»Y¿MiT}I4-Q4-Y4-a4-i®9q·9 I½9%I¿9%Q½9%Q¿9%QÁ9%Y½9‘Y¿9‘YÁ9‘a½9%a¿9%aÁ9%aÃ9%i½9%i¿9%iÁ9%iÃ9%qÅ9%qÇ9%qÉ9%qË9%ùÍ9+ùÛ91™:>ù:³1 :f¡+:kù=:p1£uùI:}1ª,‚¡Z:kA`:“1u+9j:U9z:ø9£ýùŠ:¬9T³9¦:À±µ:QùÆ:}A_/ÒAÔ:¥Aæ:cIö:Üù;âÜTMÜTlÜUÜlòÜŸþÜP ôÜ=ìÜD ¿
ÜnìÜ/¿
Ü—M¹TMÜû
ìTMìTlìUì.ì=Fì,VìTFìlìnFì—MìÅ¿
ì/¿
ìû\‰TlI+8è‰é+U‰/z‘×0ˆ¹T1	ÙT}üTMü‡;F¡L&ü—MI££I£­,µI£ºI£ÂI£ÊüŒ;ù	üUü¾,ù	TM‡;FTM)nì$TMnì9ª,>—M¾,ù	Œ;ù	)™TM™T}™T²	éTMINS[~ ¢ ¤$¦(¨,ª0¬4®8°<²@´D¶H¸LºP¼T[X¾\Ë`Ödóhûlþptx|
€
„ˆŒ”˜œ" %¤(¨+¬.°1´4¸7¼:À=Ä@à´ä¹è¾ìÃðNôÈøÍüÒS×Ü´¹¾PaTfXk\p`udzhl„p‰tŽx“|˜€„¢ˆ§Œ¬±”¶˜»è´ì¹ð¾ôÃøN@´D¹H¾LÃPNTÈXÍ\Ò`Sd×hÜl_	¬´°¹´¾¸Ã¼NÀÈÄÍÈÒ'K
¹.;].3T£{Ÿc{Ÿƒ{Ÿs¹Cs¹cs¹
s¹¡
s¹Á
s¹á
s¹s¹!s¹As¹as¹s¹¡s¹Ás¹ás¹s¹!s¹As¹as¹s¹¡s¹Ás¹ás¹
s¹!
s¹A
s¹a
s¹s¹ s¹@s¹`s¹€s¹ s¹Às¹às¹s¹ s¹@s¹`s¹€s¹ s¹Às¹às¹s¹ s¹@s¹`s¹€s¹ s¹Às¹às¹D8#¹|
)p,À	Ç	Ö	à	þ	%
i
~
…
–
§
¹
Å
Ü
ä
ò
ö
ü
Lz‰‘—¥ª»ÀÉâîþ7f{‚Ê	

$
3
Ù
L™ý©Îÿ
8q×4Ml…–¢­Ðõû7FWƒ‡Ÿ¥Ì'-28>DJPs‚ŽçEK
+/012345678>B#G%KÈ
®Ô
³Ü
³È
®<³IÕÔ
³€³Š³“³™³ ³©³¬cÔ
³€³Š³“³™³ ³©³²c׳g-³X³‚k¦k̳鳳&³A³]³{³™³¾³âpu=u[z[€ÅgͪÓg×gW
EW
EW
EW
EW
EW
EW
EW
EW
EW
E¬cê ³õ ûú [W
E¬cê ³[Wb$³p$³‰$³”$cš$óª&c¶&³%T	Â&³b$³p$³‰$³(³”$—	×gFGHIJKM	L	NOQ
P
˜™š›œž­®¯!°#±%²'³)´+µ-¶/·1¸3¹5º7»9¼;½=¾?¿AÀCÁEÂGÃIÄKÅMÆMÇOÈOÉQÊQËSÌSÎUÍU
WY[
]_iarc}eˆg–ik§m­o¸q¾s¿uÀwÁyÂ{Ã{Ð}àáãƒâƒð…ñ…ò‡ó‡ô‰õ‹ö!"#‘$‘%“&•'•D—C—E™F™G›HIŸJ¡
j
l
n
p	
r
t

v
x0
z2
|4
~6
€8
‚:
„<
†
ˆ
Š
Œ
Ž

’
”
À!
Â#
Ä%
Æ'
È)
Ê+
Ì-
Î>
Ð@
ÒB
ÔF
ÖH
ØJ
ÚL
ÜN
ÞR
àT
âV
äX
æ/
è1
ê3
ì5
î7
ð9
ò;
ô=
ö?
øAœCž-Ú-ÜE
%18?ñ
äc
m
~
ˆ
œ
¦
¶
ë
ô
ý
*7?jz…³ÂT®¿Æ&)0NXadnŒ©°¼ÉÑòú">`~ºÃ(éf”ÒÙ -50Jô8Jõ@JöPJ÷‰ø€5
Ór )(*+,(46<T4V6V<í4ï4ñ4÷4ù6ù<<Module>OpenMetaverse.StructuredData.dllOSDParserOpenMetaverse.StructuredDataPropertyMetadataLitJsonArrayMetadataObjectMetadataExporterFuncExporterFunc`1ImporterFuncImporterFunc`2WrapperFactoryJsonMapperIJsonWrapperJsonDataOrderedDictionaryEnumeratorOSDTypeOSDFormatOSDExceptionOSDOSDBooleanOSDIntegerOSDRealOSDStringOSDUUIDOSDDateOSDUriOSDBinaryOSDMapOSDArrayParserTokenFsmContextLexerStateHandlerConditionWriterContextJsonWriterJsonTokenJsonReaderJsonExceptionJsonTypemscorlibSystemObjectValueTypeMulticastDelegateTTJsonTValueSystem.CollectionsIListSystem.Collections.SpecializedIOrderedDictionaryIDictionaryICollectionIEnumerableIEquatable`1IDictionaryEnumeratorIEnumeratorEnumExceptionSystem.Collections.GenericIDictionary`2ICollection`1KeyValuePair`2IEnumerable`1IList`1ApplicationExceptioninitialBufferSizeint32LengthdoubleLengthllsdBinaryHeadllsdBinaryHead2undefBinaryValuetrueBinaryValuefalseBinaryValueintegerBinaryMarkerrealBinaryMarkeruuidBinaryMarkerbinaryBinaryMarkerstringBinaryMarkeruriBinaryMarkerdateBinaryMarkerarrayBeginBinaryMarkerarrayEndBinaryMarkermapBeginBinaryMarkermapEndBinaryMarkerkeyBinaryMarkerLLSD_BINARY_HEADERLLSD_XML_HEADERLLSD_XML_ALT_HEADERLLSD_XML_ALT2_HEADERbaseIndentundefNotationValuetrueNotationValueOnetrueNotationValueTwotrueNotationValueThreefalseNotationValueOnefalseNotationValueTwofalseNotationValueThreeintegerNotationMarkerrealNotationMarkeruuidNotationMarkerbinaryNotationMarkerstringNotationMarkeruriNotationMarkerdateNotationMarkerarrayBeginNotationMarkerarrayEndNotationMarkermapBeginNotationMarkermapEndNotationMarkerkommaNotationDelimiterkeyNotationDelimitersizeBeginNotationMarkersizeEndNotationMarkerdoubleQuotesNotationMarkersingleQuotesNotationMarkerllsdBinaryHeadBytesDeserializeLLSDBinarySystem.IOStreamSerializeLLSDBinaryMemoryStreamSerializeLLSDBinaryStreamSerializeLLSDBinaryElementSerializeLLSDBinaryArraySerializeLLSDBinaryMapParseLLSDBinaryElementParseLLSDBinaryArrayParseLLSDBinaryMapSkipWhiteSpaceFindByteFindStringConsumeBytesNetworkToHostIntNetworkToHostDoubleHostToNetworkIntBytesDeserializetrueNotationValueTwoFulltrueNotationValueThreeFullfalseNotationValueTwoFullfalseNotationValueThreeFullDeserializeLLSDNotationStringReaderSerializeLLSDNotationStringWriterSerializeLLSDNotationStreamSerializeLLSDNotationFormattedSerializeLLSDNotationStreamFormattedDeserializeLLSDNotationElementDeserializeLLSDNotationIntegerDeserializeLLSDNotationRealDeserializeLLSDNotationArrayDeserializeLLSDNotationMapSerializeLLSDNotationElementSerializeLLSDNotationArraySerializeLLSDNotationMapSerializeLLSDNotationElementFormattedSerializeLLSDNotationArrayFormattedSerializeLLSDNotationMapFormattedPeekAndSkipWhitespaceReadAndSkipWhitespaceGetLengthInBracketsGetStringDelimitedByBufferCharactersEqualUnescapeCharacterEscapeCharacterDeserializeJsonSerializeJsonStringSerializeJsonSerializeJsonNoDefaultsSystem.XmlSystem.Xml.SchemaXmlSchemaXmlTextReaderLastXmlErrorsXmlValidationLockDeserializeLLSDXmlSerializeLLSDXmlBytesSerializeLLSDXmlStringXmlTextWriterSerializeLLSDXmlElementTryValidateLLSDXmlParseLLSDXmlElementParseLLSDXmlMapParseLLSDXmlArraySkipWhitespaceCreateLLSDXmlSchemaValidationEventArgsLLSDXmlSchemaValidationHandlerSystem.ReflectionMemberInfoInfoIsFieldTypeelement_typeis_arrayis_listget_ElementTypeset_ElementTypeget_IsArrayset_IsArrayget_IsListset_IsListElementTypeIsArrayIsListis_dictionarypropertiesget_IsDictionaryset_IsDictionaryget_Propertiesset_PropertiesIsDictionaryProperties.ctorInvokeIAsyncResultAsyncCallbackBeginInvokeEndInvokemax_nesting_depthIFormatProviderdatetime_formatbase_exporters_tablecustom_exporters_tablebase_importers_tablecustom_importers_tablearray_metadataarray_metadata_lockMethodInfoconv_opsconv_ops_lockobject_metadataobject_metadata_locktype_propertiestype_properties_lockstatic_writerstatic_writer_lock.cctorAddArrayMetadataAddObjectMetadataAddTypePropertiesGetConvOpReadValueRegisterBaseExportersRegisterBaseImportersRegisterImporterWriteValueToJsonToObjectTextReaderToWrapperRegisterExporterUnregisterExportersUnregisterImportersget_IsBooleanget_IsDoubleget_IsIntget_IsLongget_IsObjectget_IsStringGetBooleanGetDoubleGetIntGetJsonTypeGetLongGetStringSetBooleanSetDoubleSetIntSetJsonTypeSetLongSetStringIsBooleanIsDoubleIsIntIsLongIsObjectIsStringinst_arrayinst_booleaninst_doubleinst_intinst_longinst_objectinst_stringjsontypeobject_listget_CountSystem.Collections.ICollection.get_CountSystem.Collections.ICollection.get_IsSynchronizedget_IsSynchronizedSystem.Collections.ICollection.get_SyncRootget_SyncRootSystem.Collections.IDictionary.get_IsFixedSizeget_IsFixedSizeSystem.Collections.IDictionary.get_IsReadOnlyget_IsReadOnlySystem.Collections.IDictionary.get_Keysget_KeysSystem.Collections.IDictionary.get_Valuesget_ValuesLitJson.IJsonWrapper.get_IsArrayLitJson.IJsonWrapper.get_IsBooleanLitJson.IJsonWrapper.get_IsDoubleLitJson.IJsonWrapper.get_IsIntLitJson.IJsonWrapper.get_IsLongLitJson.IJsonWrapper.get_IsObjectLitJson.IJsonWrapper.get_IsStringSystem.Collections.IList.get_IsFixedSizeSystem.Collections.IList.get_IsReadOnlySystem.Collections.IDictionary.get_Itemget_ItemSystem.Collections.IDictionary.set_Itemset_ItemSystem.Collections.Specialized.IOrderedDictionary.get_ItemSystem.Collections.Specialized.IOrderedDictionary.set_ItemSystem.Collections.IList.get_ItemSystem.Collections.IList.set_Itemop_Implicitop_ExplicitArraySystem.Collections.ICollection.CopyToCopyToSystem.Collections.IDictionary.AddAddSystem.Collections.IDictionary.ClearClearSystem.Collections.IDictionary.ContainsContainsSystem.Collections.IDictionary.GetEnumeratorGetEnumeratorSystem.Collections.IDictionary.RemoveRemoveSystem.Collections.IEnumerable.GetEnumeratorLitJson.IJsonWrapper.GetBooleanLitJson.IJsonWrapper.GetDoubleLitJson.IJsonWrapper.GetIntLitJson.IJsonWrapper.GetLongLitJson.IJsonWrapper.GetStringLitJson.IJsonWrapper.SetBooleanLitJson.IJsonWrapper.SetDoubleLitJson.IJsonWrapper.SetIntLitJson.IJsonWrapper.SetLongLitJson.IJsonWrapper.SetStringLitJson.IJsonWrapper.ToJsonSystem.Collections.IList.AddSystem.Collections.IList.ClearSystem.Collections.IList.ContainsSystem.Collections.IList.IndexOfIndexOfSystem.Collections.IList.InsertInsertSystem.Collections.IList.RemoveSystem.Collections.IList.RemoveAtRemoveAtSystem.Collections.Specialized.IOrderedDictionary.GetEnumeratorSystem.Collections.Specialized.IOrderedDictionary.InsertSystem.Collections.Specialized.IOrderedDictionary.RemoveAtEnsureCollectionEnsureDictionaryEnsureListToJsonDataWriteJsonEqualsToStringCountSystem.Collections.ICollection.CountSystem.Collections.ICollection.IsSynchronizedSystem.Collections.ICollection.SyncRootSystem.Collections.IDictionary.IsFixedSizeSystem.Collections.IDictionary.IsReadOnlySystem.Collections.IDictionary.KeysSystem.Collections.IDictionary.ValuesLitJson.IJsonWrapper.IsArrayLitJson.IJsonWrapper.IsBooleanLitJson.IJsonWrapper.IsDoubleLitJson.IJsonWrapper.IsIntLitJson.IJsonWrapper.IsLongLitJson.IJsonWrapper.IsObjectLitJson.IJsonWrapper.IsStringSystem.Collections.IList.IsFixedSizeSystem.Collections.IList.IsReadOnlySystem.Collections.IDictionary.ItemSystem.Collections.Specialized.IOrderedDictionary.ItemSystem.Collections.IList.ItemItemIEnumerator`1list_enumeratorget_CurrentDictionaryEntryget_Entryget_Keyget_ValueMoveNextResetCurrentEntryKeyValuevalue__UnknownBooleanIntegerRealStringUUIDDateURIBinaryMapXmlJsonget_TypeAsBooleanAsIntegerAsUIntegerAsLongAsULongAsRealAsStringOpenMetaverseTypesOpenMetaverseAsUUIDDateTimeAsDateUriAsUriAsBinaryVector2AsVector2Vector3AsVector3Vector3dAsVector3dVector4AsVector4QuaternionAsQuaternionColor4AsColor4FromBooleanFromIntegerFromUIntegerFromLongFromULongFromRealFromStringFromUUIDFromDateFromUriFromBinaryFromVector2FromVector3FromVector3dFromVector4FromQuaternionFromColor4FromObjectSerializeMembersDeserializeMembersvaluetrueBinaryfalseBinaryDictionary`2ContainsKeyTryGetValueSystem.Collections.Generic.IEnumerable<System.Collections.Generic.KeyValuePair<System.String,OpenMetaverse.StructuredData.OSD>>.GetEnumeratorIsReadOnlyKeysValuesList`1System.Collections.Generic.IEnumerable<OpenMetaverse.StructuredData.OSD>.GetEnumeratorNoneNumberTrueFalseNullCharSeqCharTextObjectPrimePairPairRestArrayPrimeValueRestEndEpsilonReturnNextStateLStateStackfsm_return_tablefsm_handler_tableallow_commentsallow_single_quoted_stringsend_of_inputfsm_contextinput_bufferinput_charreaderstateSystem.TextStringBuilderstring_bufferstring_valuetokenunicharget_AllowCommentsset_AllowCommentsget_AllowSingleQuotedStringsset_AllowSingleQuotedStringsget_EndOfInputget_Tokenget_StringValueHexValuePopulateFsmTablesProcessEscCharState1State2State3State4State5State6State7State8State9State10State11State12State13State14State15State16State17State18State19State20State21State22State23State24State25State26State27State28GetCharNextCharNextTokenUngetCharAllowCommentsAllowSingleQuotedStringsEndOfInputTokenStringValueInArrayInObjectNotAPropertyPropertyExpectingValuePaddingSystem.GlobalizationNumberFormatInfonumber_formatcontextStack`1ctx_stackhas_reached_endhex_seqindentationindent_valueinst_string_builderpretty_printvalidateTextWriterwriterget_IndentValueset_IndentValueget_PrettyPrintset_PrettyPrintget_TextWriterget_Validateset_ValidateDoValidationInitIntToHexIndentPutPutNewlinePutStringUnindentWriteDecimalWriteArrayEndWriteArrayStartWriteObjectEndWriteObjectStartWritePropertyNameIndentValuePrettyPrintValidateObjectStartPropertyNameObjectEndArrayStartArrayEndIntLongDoubleparse_tableautomaton_stackcurrent_inputcurrent_symbolend_of_jsonlexerparser_in_stringparser_returnread_startedreader_is_ownedtoken_valueget_EndOfJsonPopulateParseTableTableAddColTableAddRowProcessNumberProcessSymbolReadTokenCloseReadEndOfJsonbinaryDatastreamosdprependHeaderdataosdArrayosdMaptoFindconsumeBytesbinaryNetEndintHostEndnotationDataindentintenddelimiterbufferoffsetscpreserveDefaultsxmlDataxmlStreamerrorSystem.Runtime.InteropServicesOutAttributesenderargsobjectmethodobjcallbackresultinputt1t2inst_typefactorytablejson_typevalue_typeimporterwriter_is_privatedepthexportervalkeyidxindexprop_namebooleannumberstrarrayxenumeratormessageserializedcapacityllsdkvpelementdigitesc_charctxsbcondnhexadd_commaproperty_namejson_textownedrowcolsymbolsParamArrayAttributeruleinner_exceptionSystem.Security.PermissionsSecurityPermissionAttributeSecurityActionSystem.Runtime.CompilerServicesCompilationRelaxationsAttributeRuntimeCompatibilityAttributeget_CanSeekToArrayWriteByteIDisposableDisposeEncodingget_UTF8GetBytesReadByteUriKindUtilsBytesToDoubleEpochDateTimeKindSpecifyKindAddSecondsToLocalTimeSeekOriginSeekget_Lengthget_Positionget_CharsStringComparisonset_PositionByteBitConverterToInt32System.NetIPAddressNetworkToHostOrderToInt64ToDoubleHostToNetworkOrderget_ASCIIStartsWithEmptyTryParseEmptyBytesPeekIsDigitInt32ConvertFromBase64StringConcatAppendTryParseDoubleWriteLineReplaceStreamReaderIsNullOrEmptyZeroop_EqualityStringToBytesXmlReaderFormattingset_FormattingXmlWriterWriteStartElementWriteEndElementWriteStringWriteStartAttributeWriteEndAttributeSystem.ThreadingMonitorEnterXmlReaderSettingsValidationTypeset_ValidationTypeXmlSchemaSetget_SchemasValidationEventHandleradd_ValidationEventHandlerCreateExitXmlExceptionXmlNodeTypeget_NodeTypeget_LocalName<PrivateImplementationDetails>{DD97B12D-3FDA-42BC-A8AD-59D31172A5B3}CompilerGeneratedAttribute$$method0x600003f-1get_IsEmptyElementReadStringTrimToLowerGetAttributeop_Inequalityget_MessageFormatExceptionNotImplementedExceptionget_LineNumberget_LinePositionFormatEnvironmentget_NewLine$$method0x6000244-1RuntimeHelpersRuntimeFieldHandleInitializeArray$$method0x6000244-2__StaticArrayInitTypeSize=10$$method0x6000244-3$$method0x6000244-4StructLayoutAttributeLayoutKindRuntimeTypeHandleGetTypeFromHandleDateTimeFormatInfoget_InvariantInfoGetInterfacePropertyInfoGetPropertiesget_NameParameterInfoGetIndexParametersget_ParameterTypeget_PropertyTypeArgumentExceptionFieldInfoGetFieldsget_FieldTypeGetMethodget_IsClassGetTypeIsAssignableFromget_IsEnumMethodBaseActivatorCreateInstanceArrayListGetElementTypeSetValueget_CanWriteInt64<RegisterBaseExporters>b__0CS$<>9__CachedAnonymousMethodDelegate9<RegisterBaseExporters>b__1CS$<>9__CachedAnonymousMethodDelegatea<RegisterBaseExporters>b__2CS$<>9__CachedAnonymousMethodDelegateb<RegisterBaseExporters>b__3CS$<>9__CachedAnonymousMethodDelegatec<RegisterBaseExporters>b__4CS$<>9__CachedAnonymousMethodDelegated<RegisterBaseExporters>b__5CS$<>9__CachedAnonymousMethodDelegatee<RegisterBaseExporters>b__6CS$<>9__CachedAnonymousMethodDelegatef<RegisterBaseExporters>b__7CS$<>9__CachedAnonymousMethodDelegate10<RegisterBaseExporters>b__8CS$<>9__CachedAnonymousMethodDelegate11SByteInt16UInt16UInt32ToUInt64UInt64<RegisterBaseImporters>b__12CS$<>9__CachedAnonymousMethodDelegate1e<RegisterBaseImporters>b__13CS$<>9__CachedAnonymousMethodDelegate1f<RegisterBaseImporters>b__14CS$<>9__CachedAnonymousMethodDelegate20<RegisterBaseImporters>b__15CS$<>9__CachedAnonymousMethodDelegate21<RegisterBaseImporters>b__16CS$<>9__CachedAnonymousMethodDelegate22<RegisterBaseImporters>b__17CS$<>9__CachedAnonymousMethodDelegate23<RegisterBaseImporters>b__18CS$<>9__CachedAnonymousMethodDelegate24<RegisterBaseImporters>b__19CS$<>9__CachedAnonymousMethodDelegate25<RegisterBaseImporters>b__1aCS$<>9__CachedAnonymousMethodDelegate26<RegisterBaseImporters>b__1bCS$<>9__CachedAnonymousMethodDelegate27<RegisterBaseImporters>b__1cCS$<>9__CachedAnonymousMethodDelegate28<RegisterBaseImporters>b__1dCS$<>9__CachedAnonymousMethodDelegate29ToByteToSByteToInt16ToUInt16ToUInt32ToSingleSingleToDecimalToCharToDateTimeGetUnderlyingTypeGetValueget_CanRead<ToObject>b__2aCS$<>9__CachedAnonymousMethodDelegate2b<ToObject>b__2cCS$<>9__CachedAnonymousMethodDelegate2d<ToObject>b__2eCS$<>9__CachedAnonymousMethodDelegate2f<>c__DisplayClass31`1<RegisterExporter>b__30<>c__DisplayClass34`2<RegisterImporter>b__33DefaultMemberAttributeInvalidCastExceptionInvalidOperationExceptionIdentityBlackXYZWRGBABytesToUInt64BytesToUIntNonSerializedAttributeAttributeIsDefinedIntToBytesBigIsNaNMathRoundCultureInfoEnUsCultureDoubleToBytesBigFloorTryCreateget_MillisecondToUniversalTimeDateTimeToUnixTimeTimeSpanop_Subtractionget_TotalSecondsDoubleToBytesget_IsAbsoluteUriget_AbsoluteUriToBase64StringBytesToHexStringKeyCollectionValueCollectionEnumerator__StaticArrayInitTypeSize=112$$method0x60001e0-1ArgumentNullExceptionPushPopKeyNotFoundExceptionSystem.SecurityUnverifiableCodeAttributemCannot deserialize binary LLSD from unseekable streams#<? llsd/binary ?><?llsd/binary?>mBinary serialization: Not existing element discovered.]Binary LLSD parsing: Unexpected end of stream.cBinary LLSD parsing: Invalid Uri format detected.SBinary LLSD parsing: Unknown type marker.cBinary LLSD parsing: Missing end marker in array._Binary LLSD parsing: Missing key marker in map._Binary LLSD parsing: Missing end marker in map.
<llsd><?xml<? llsd/xml ?>uCannot deserialize structured data from unseekable streamsaNotation LLSD parsing: True value parsing error:qNotation LLSD parsing: Unexpected end of stream in UUID._Notation LLSD parsing: Invalid UUID discovered.uNotation LLSD parsing: Unexpected end of stream in binary.sNotation LLSD parsing: Raw binary encoding not supported.iNotation LLSD parsing: Invalid binary encoding base.INotation LLSD parsing: Encoding base# + not supported.uNotation LLSD parsing: Unexpected end of stream in string.gNotation LLSD parsing: Invalid Uri format detected.qNotation LLSD parsing: Unexpected end of stream in date._Notation LLSD parsing: Invalid date discovered.YNotation LLSD parsing: Unknown type marker ''.cNotation LLSD parsing: Can't parse integer value._Notation LLSD parsing: Can't parse real value: uNotation LLSD parsing: Unexpected end of array discovered.SNotation LLSD parsing: Invalid key in mapoNotation LLSD parsing: Unexpected end of stream in map.aNotation LLSD parsing: Invalid delimiter in map.qNotation LLSD parsing: Unexpected end of map discovered.64qNotation serialization: Not existing element discovered.  €ŸNotation LLSD parsing: Can't parse length value cause unexpected end of stream.aNotation LLSD parsing: Can't parse length value.€¹Notation LLSD parsing: Can't parse text because unexpected end of stream while expecting a '' character.\\\	llsdundefbooleaninteger	real
string	uuid	dateuri
binaryencoding
base64mapkeyarray'Expected an element	true1nan;Unsupported binary encoding: 7Binary decoding exception: Expected </>Expected <map>Expected <key>Expected </key>AFailed to parse a value for key !Expected <array>•

<?xml version="1.0" encoding="utf-8"?>

<xs:schema elementFormDefault="qualified" xmlns:xs="http://www.w3.org/2001/XMLSchema">

  <xs:import schemaLocation="xml.xsd" namespace="http://www.w3.org/XML/1998/namespace" />

  <xs:element name="uri" type="xs:string" />

  <xs:element name="uuid" type="xs:string" />

  <xs:element name="KEYDATA">

    <xs:complexType>

      <xs:sequence>

        <xs:element ref="key" />

        <xs:element ref="DATA" />

      </xs:sequence>

    </xs:complexType>

  </xs:element>

  <xs:element name="date" type="xs:string" />

  <xs:element name="key" type="xs:string" />

  <xs:element name="boolean" type="xs:string" />

  <xs:element name="undef">

    <xs:complexType>

      <xs:sequence>

        <xs:element ref="EMPTY" />

      </xs:sequence>

    </xs:complexType>

  </xs:element>

  <xs:element name="map">

    <xs:complexType>

      <xs:sequence>

        <xs:element minOccurs="0" maxOccurs="unbounded" ref="KEYDATA" />

      </xs:sequence>

    </xs:complexType>

  </xs:element>

  <xs:element name="real" type="xs:string" />

  <xs:element name="ATOMIC">

    <xs:complexType>

      <xs:choice>

        <xs:element ref="undef" />

        <xs:element ref="boolean" />

        <xs:element ref="integer" />

        <xs:element ref="real" />

        <xs:element ref="uuid" />

        <xs:element ref="string" />

        <xs:element ref="date" />

        <xs:element ref="uri" />

        <xs:element ref="binary" />

      </xs:choice>

    </xs:complexType>

  </xs:element>

  <xs:element name="DATA">

    <xs:complexType>

      <xs:choice>

        <xs:element ref="ATOMIC" />

        <xs:element ref="map" />

        <xs:element ref="array" />

      </xs:choice>

    </xs:complexType>

  </xs:element>

  <xs:element name="llsd">

    <xs:complexType>

      <xs:sequence>

        <xs:element ref="DATA" />

      </xs:sequence>

    </xs:complexType>

  </xs:element>

  <xs:element name="binary">

    <xs:complexType>

      <xs:simpleContent>

        <xs:extension base="xs:string">

          <xs:attribute default="base64" name="encoding" type="xs:string" />

        </xs:extension>

      </xs:simpleContent>

    </xs:complexType>

  </xs:element>

  <xs:element name="array">

    <xs:complexType>

      <xs:sequence>

        <xs:element minOccurs="0" maxOccurs="unbounded" ref="DATA" />

      </xs:sequence>

    </xs:complexType>

  </xs:element>

  <xs:element name="integer" type="xs:string" />

  <xs:element name="string">

    <xs:complexType>

      <xs:simpleContent>

        <xs:extension base="xs:string">

          <xs:attribute ref="xml:space" />

        </xs:extension>

      </xs:simpleContent>

    </xs:complexType>

  </xs:element>

</xs:schema>

?Line: {0} - Position: {1} - {2}1System.Collections.IList	Item=System.Collections.IDictionaryop_ImplicitYCan't assign null to an instance of type {0}_Can't assign value '{0}' (type {1}) to type {2}=Type {0} can't act as an arrayYThe type {0} doesn't have the property '{1}'€‹Max allowed object depth reached while trying to export from type {0}5The key has to be a string[Unable to wrap the given object with JsonDataUInstance of JsonData doesn't hold a doubleQInstance of JsonData doesn't hold an intUInstance of JsonData doesn't hold a stringQJsonData instance doesn't hold a booleanOJsonData instance doesn't hold a doubleKJsonData instance doesn't hold an intKJsonData instance doesn't hold a longOJsonData instance doesn't hold a stringcThe JsonData instance has to be initialized firstQInstance of JsonData is not a dictionaryEInstance of JsonData is not a listJsonData arrayJsonData object-Uninitialized JsonData0rfalse/yyyy-MM-ddTHH:mm:ss.ffZ)yyyy-MM-ddTHH:mm:ssZ
writer_A complete JSON symbol has already been written3Can't close an array here5Can't close an object here'Expected a property3Can't add a property here-Can't add a value here\n\r\t\f\b\u.0	null][}{: 
readerUInput doesn't evaluate to proper JSON textGInvalid token '{0}' in input stringOInvalid character '{0}' in input string-±—ÝÚ?¼B¨­YÓr¥³·z\V4à‰%49H=AHEAHIH=HEH€"<? llsd/binary ?><?llsd/binary?>!10irubsld[]{}k<llsd>
<?xml<? llsd/xml ?>  !1tT0fFirubsld[]{},:()"'HHQHHUHUHUHUpUlQQQQ
HHYH]H]H]p]l]H]p]lYYYH4H
H€Œ4H4HaeHeiHelepeemqu u u  (u(9	 9
 9	(9  €Œ y€Œ} y €Œ y€Œ}  y} y 	 y} y 0 y} 0y€	9u9u9u 	9u9u9u€…	9u
9uI€Œu	€…uuu€”	0(€”9u9u uu 	€Œ€Œ4€”4€‰4€”€‰0(
$  
  €œ 
  
  €œ 
  €ŒI4

94€œIA4      4 4 4 4 44
44
4
44
44 €  ) -     40€Œ 4((((((4(4
€‘A4 €• €‘A4(€•<	
@ < 	  €™ € €¡  €¥ €© €­ €± €µ €¹HHH	HHHHH
HH
HH€™H€H€¡H€¥H€©H€­H€±H€µH€¹HuHHH	H
HH
HH€™H€H€¡H€¥H€©H€­H€±H€µH€¹Hll(<€™ €™€ €€¡ €¡  	 	€½H €½H = =H H H 
 AH H
 AH AH €‘AH	 €‘(=(=H(H€ÁH
 €ÁH H H H H H H	 €‘H(Ht	

|€€x€‰€Å €‰x( x	 yx} y€„€É€ˆ	€Í€ˆ€Ñ €Ñ €Å €Ñ €„ €Õ(€Ñ€
99€Í € €‰tt(€ t t5 5 5 €åUHU U <€‘H 
H€‘HAH€õ  AH)€ñ   €ù
€€ €

H
€¡
€pl 

  	
 






 YHH]]  €™€ H€™€¡€ €Å€Å
ہ
plH <AH)ۖہ   Q
)€”H
pl)€œ 
44p4lAH4<)ۖ	۪۪'
€™44p4lAH4<)€ñ HH 1 ]ilAHp<)€ñ A E aa I--=
=- Q€½€½   H
€™€Ylp	aQIU	€i€¤ quu	€½u€½u9u€…	€½u
€½uIy	€½u€½u9u 9u  u } }}9u€½9 ‰}‰}‰9uI€Á= 
I}‰}‰9u9u€…
€½u€…	9u€…	 €…u
€…€…u u9u9u 9u u u€u  u  €…u}
00€	€€	9u 	
€Õ

	€€ 	€½u uuE€‘0€•uuI}-€ñ-€ñ)€ñ€‘0(€”€¨€¨€¨	$	€¬$	€¬
 €¬=Au=Au9u 	Item€ÁEA4€‘A4A4=IA4€‘A4€Á4=4I4A4€‘A44IA4 	A494 4A4A4=A4A4A4I4A4A44A4
A44A4€½4€ÁA4€•-€ñ)€ñ  
 
 €œ]€Œ€¥€©€­€±€µ€¹	quu‰l‰Hu‰‰H


Õ €

€™€€ù€¡€¡€	€ Ù€€Ù	€¡€¡€½H Ý á ååH€ÁHh€¥€©€­€±€µ€¹ 	 ééH€°€€ €Å€€€É€„€Í€ˆ	€Õ€
€ €
€€€Í
€½98999€½


ñTWrapNonExceptionThrows€ž.€„System.Security.Permissions.SecurityPermissionAttribute, mscorlib, Version=2.0.0.0, Culture=neutral, PublicKeyToken=b77a5c561934e089TSkipVerificationh~~~ p~_CorDllMainmscoree.dllÿ% €0€HX€œœ4VS_VERSION_INFO½ïþ?DVarFileInfo$Translation°üStringFileInfoØ000004b0,FileDescription 0FileVersion0.0.0.0d!InternalNameOpenMetaverse.StructuredData.dll(LegalCopyright l!OriginalFilenameOpenMetaverse.StructuredData.dll4ProductVersion0.0.0.08Assembly Version0.0.0.0p>
ViewGit